IPPK Antibody

Images

 
Western Blot: IPPK Antibody [NBP1-74180] - Mouse Liver lysate, concentration 1 ug/ml.

Product Details

Summary
Product Discontinued
View other related IPPK Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74180
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IPPK Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Ippk. Immunizing peptide sequence VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS.
Clonality
Polyclonal
Host
Rabbit
Gene
IPPK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ippk and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IPPK Antibody

  • bA476B13.1 (novel protein)
  • bA476B13.1
  • C9orf12
  • chromosome 9 open reading frame 12
  • EC 2.7.1.158
  • FLJ13163
  • inositol 13,45,6-pentakisphosphate 2-kinase
  • Inositol-13,45,6-pentakisphosphate 2-kinase
  • inositol-pentakisphosphate 2-kinase
  • Ins(13,45,6)P5 2-kinase
  • InsP5 2-kinase
  • INSP5K2
  • IP5K
  • IPK1 homolog
  • IPK1
  • KIAA0699

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76975
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-89426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-38213
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84121
Species: Hu
Applications: IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-65538
Species: Hu
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-49832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-88706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IPPK Antibody (NBP1-74180) (0)

There are no publications for IPPK Antibody (NBP1-74180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IPPK Antibody (NBP1-74180) (0)

There are no reviews for IPPK Antibody (NBP1-74180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IPPK Antibody (NBP1-74180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IPPK Antibody (NBP1-74180)

Discover related pathways, diseases and genes to IPPK Antibody (NBP1-74180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IPPK Antibody (NBP1-74180)

Discover more about diseases related to IPPK Antibody (NBP1-74180).

Blogs on IPPK

There are no specific blogs for IPPK, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IPPK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IPPK
Uniprot