Intra Acrosomal Protein Recombinant Protein Antigen

Images

 
There are currently no images for Intra Acrosomal Protein Protein (NBP1-88038PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Intra Acrosomal Protein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACRV1.

Source: E. coli

Amino Acid Sequence: SGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACRV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88038. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Intra Acrosomal Protein Recombinant Protein Antigen

  • acrosomal protein SP-10
  • acrosomal vesicle protein 1D11S4365
  • SP-10
  • SPACA2
  • sperm protein 10

Background

Intra Acrosomal Protein is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The gene encoding this protein consists of 4 exons and its alternative splicing generates 11 distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining 7 transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31637
Species: Hu
Applications: IHC,  IHC-P
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
366-6C
Species: Hu
Applications: BA
NBP2-13370
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-69021
Species: Hu
Applications: IHC,  IHC-P
DY346
Species: Hu
Applications: ELISA
NBP2-69049
Species: Hu
Applications: IHC,  IHC-P
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89136
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-52911
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88038PEP
Species: Hu
Applications: AC

Publications for Intra Acrosomal Protein Protein (NBP1-88038PEP) (0)

There are no publications for Intra Acrosomal Protein Protein (NBP1-88038PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Intra Acrosomal Protein Protein (NBP1-88038PEP) (0)

There are no reviews for Intra Acrosomal Protein Protein (NBP1-88038PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Intra Acrosomal Protein Protein (NBP1-88038PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Intra Acrosomal Protein Products

Blogs on Intra Acrosomal Protein

There are no specific blogs for Intra Acrosomal Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Intra Acrosomal Protein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACRV1