Integrin beta 6 Antibody (4C3)

Images

 
ELISA: Integrin beta 6 Antibody (4C3) [H00003694-M03] - Detection limit for recombinant GST tagged ITGB6 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin beta 6 Antibody (4C3) Summary

Immunogen
ITGB6 (NM_000888 604 a.a. - 707 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPN
Specificity
ITGB6 - integrin, beta 6 (4C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGB6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin beta 6 Antibody (4C3)

  • Integrin beta 6
  • integrin beta-6
  • integrin, beta 6
  • ITGB6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-87447
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006326-Q01
Species: Hu
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF4669
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00003694-M03
Species: Hu
Applications: WB, ELISA

Publications for Integrin beta 6 Antibody (H00003694-M03) (0)

There are no publications for Integrin beta 6 Antibody (H00003694-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 6 Antibody (H00003694-M03) (0)

There are no reviews for Integrin beta 6 Antibody (H00003694-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 6 Antibody (H00003694-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta 6 Products

Bioinformatics Tool for Integrin beta 6 Antibody (H00003694-M03)

Discover related pathways, diseases and genes to Integrin beta 6 Antibody (H00003694-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 6 Antibody (H00003694-M03)

Discover more about diseases related to Integrin beta 6 Antibody (H00003694-M03).
 

Pathways for Integrin beta 6 Antibody (H00003694-M03)

View related products by pathway.

PTMs for Integrin beta 6 Antibody (H00003694-M03)

Learn more about PTMs related to Integrin beta 6 Antibody (H00003694-M03).
 

Research Areas for Integrin beta 6 Antibody (H00003694-M03)

Find related products by research area.

Blogs on Integrin beta 6

There are no specific blogs for Integrin beta 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 6 Antibody (4C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB6
Entrez
Uniprot