Integrin alpha E/CD103 Antibody [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Integrin alpha E/CD103 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88142G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Integrin alpha E/CD103 Antibody [DyLight 488] Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN
Specificity
Specificity of human Integrin alpha E/CD103 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Immunogen affinity purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Integrin alpha E/CD103 Antibody [DyLight 488]

  • antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide
  • CD103 antigen
  • CD103
  • HML-1 antigen
  • HUMINAE
  • Integrin alpha E
  • integrin alpha-E
  • Integrin alpha-IEL
  • integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide)
  • ITGAE
  • MGC141996
  • Mucosal lymphocyte 1 antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-39002
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single Cell Western
NB110-97871
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB110-89474
Species: Hu, Mu, Rt, Bv, ChHa
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Dual ISH-IHC, Single Cell Western
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
6507-IL/CF
Species: Hu
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready

Publications for Integrin alpha E/CD103 Antibody (NBP1-88142G) (0)

There are no publications for Integrin alpha E/CD103 Antibody (NBP1-88142G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha E/CD103 Antibody (NBP1-88142G) (0)

There are no reviews for Integrin alpha E/CD103 Antibody (NBP1-88142G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin alpha E/CD103 Antibody (NBP1-88142G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Integrin alpha E/CD103 Products

Bioinformatics Tool for Integrin alpha E/CD103 Antibody (NBP1-88142G)

Discover related pathways, diseases and genes to Integrin alpha E/CD103 Antibody (NBP1-88142G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha E/CD103 Antibody (NBP1-88142G)

Discover more about diseases related to Integrin alpha E/CD103 Antibody (NBP1-88142G).
 

Pathways for Integrin alpha E/CD103 Antibody (NBP1-88142G)

View related products by pathway.

Research Areas for Integrin alpha E/CD103 Antibody (NBP1-88142G)

Find related products by research area.

Blogs on Integrin alpha E/CD103

There are no specific blogs for Integrin alpha E/CD103, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha E/CD103 Antibody [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAE
Novus 100% Guarantee