Integrin alpha E/CD103 Antibody (6B8)

Images

 
Sandwich ELISA: Integrin alpha E/CD103 Antibody (6B8) [H00003682-M01] - Detection limit for recombinant GST tagged ITGAE is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin alpha E/CD103 Antibody (6B8) Summary

Immunogen
ITGAE (NP_002199, 57 a.a. - 171 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Specificity
ITGAE - integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGAE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha E/CD103 Antibody (6B8)

  • antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide
  • CD103 antigen
  • CD103
  • HML-1 antigen
  • HUMINAE
  • Integrin alpha E
  • integrin alpha-E
  • Integrin alpha-IEL
  • integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide)
  • ITGAE
  • MGC141996
  • Mucosal lymphocyte 1 antigen

Background

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready

Publications for Integrin alpha E/CD103 Antibody (H00003682-M01) (0)

There are no publications for Integrin alpha E/CD103 Antibody (H00003682-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha E/CD103 Antibody (H00003682-M01) (0)

There are no reviews for Integrin alpha E/CD103 Antibody (H00003682-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha E/CD103 Antibody (H00003682-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha E/CD103 Products

Bioinformatics Tool for Integrin alpha E/CD103 Antibody (H00003682-M01)

Discover related pathways, diseases and genes to Integrin alpha E/CD103 Antibody (H00003682-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha E/CD103 Antibody (H00003682-M01)

Discover more about diseases related to Integrin alpha E/CD103 Antibody (H00003682-M01).
 

Pathways for Integrin alpha E/CD103 Antibody (H00003682-M01)

View related products by pathway.

Blogs on Integrin alpha E/CD103

There are no specific blogs for Integrin alpha E/CD103, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha E/CD103 Antibody (6B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAE
Entrez
OMIM
Uniprot