Integrin alpha 9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Integrin alpha 9 Antibody [NBP1-90188] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
Immunohistochemistry-Paraffin: Integrin alpha 9 Antibody [NBP1-90188] - Staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Integrin alpha 9 Antibody [NBP1-90188] - Staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Integrin alpha 9 Antibody [NBP1-90188] - Staining of human liver shows moderate membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: Integrin alpha 9 Antibody [NBP1-90188] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Integrin alpha 9 Protein (NBP1-90188PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 9 Antibody

  • ALPHA-RLC
  • Integrin alpha 9
  • integrin alpha-9
  • Integrin alpha-RLC
  • integrin, alpha 9
  • ITGA4L
  • ITGA9
  • RLC
  • RLC-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56552
Species: Hu
Applications: WB
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90188
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Integrin alpha 9 Antibody (NBP1-90188) (0)

There are no publications for Integrin alpha 9 Antibody (NBP1-90188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 9 Antibody (NBP1-90188) (0)

There are no reviews for Integrin alpha 9 Antibody (NBP1-90188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Integrin alpha 9 Antibody (NBP1-90188). (Showing 1 - 1 of 1 FAQ).

  1. In mice, ITGA9 is reported to be a good marker for the valves in lymphatic collecting vessels. Have you tested this antibody on mesentery or another FFPE tissue that would tell you if this is also true in human or whether this ab has this specificity?
    • We have only tested this antibody on human kidney tissue as shown on our website. The exact immunogen sequence is also available on our website. This particular antibody was made to the human ITGA9 protein. It is possible that it may be expressed in the same manner as the mouse protein, but we have not tested this antibody on mouse samples.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 9 Products

Bioinformatics Tool for Integrin alpha 9 Antibody (NBP1-90188)

Discover related pathways, diseases and genes to Integrin alpha 9 Antibody (NBP1-90188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 9 Antibody (NBP1-90188)

Discover more about diseases related to Integrin alpha 9 Antibody (NBP1-90188).
 

Pathways for Integrin alpha 9 Antibody (NBP1-90188)

View related products by pathway.

PTMs for Integrin alpha 9 Antibody (NBP1-90188)

Learn more about PTMs related to Integrin alpha 9 Antibody (NBP1-90188).

Blogs on Integrin alpha 9

There are no specific blogs for Integrin alpha 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA9
Entrez