Home » Integrin alpha 9 » Integrin alpha 9 Antibodies » Integrin alpha 9 Antibody (9E340)

Integrin alpha 9 Antibody (9E340)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Integrin alpha 9 Antibody (3E4) [H00003680-M01] - ITGA9 monoclonal antibody (M01), clone 3E4. Analysis of ITGA9 expression in HepG2.
Western Blot: Integrin alpha 9 Antibody (3E4) [H00003680-M01] - ITGA9 monoclonal antibody (M01), clone 3E4. Analysis of ITGA9 expression in HepG2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
9E340
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Integrin alpha 9 Antibody (9E340) Summary

Immunogen
ITGA9 (NP_002198 785 a.a. - 886 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR
Specificity
ITGA9 - integrin, alpha 9
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGA9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00003680-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 9 Antibody (9E340)

  • ALPHA-RLC
  • Integrin alpha 9
  • integrin alpha-9
  • Integrin alpha-RLC
  • integrin, alpha 9
  • ITGA4L
  • ITGA9
  • RLC
  • RLC-alpha

Background

This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin light chain
kinase Antibody (SU40 ...
NBP2-67486
Western Blot: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of MYLK on human lung lysates using anti-MYLK antibody at 1/5,000 dilution.
Immunocytochemistry/Immunofluorescence: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Staining MYLK in L6 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of paraffin-embedded rat smooth muscle tissue using anti-MYLK antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(24 Publications)
Species: Multi
Applications: WB, ICC
MYLK2 Antibody
NBP2-32489
Western Blot: MYLK2 Antibody [NBP2-32489] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: MYLK2 Antibody [NBP2-32489] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32489] - Staining of human heart muscle shows low expression as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MYLK3 Antibody
NBP2-62682
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Analysis in human heart muscle and pancreas tissues using Anti-MYLK3 antibody. Corresponding MYLK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
CCL19/MIP-3 beta
[Unconjugated]
361-MI/CF
CCL19/MIP-3 beta [Unconjugated]
(28 Publications)
Species: Hu
CTDSPL Antibody
NBP2-31913
Immunocytochemistry/Immunofluorescence: CTDSPL Antibody [NBP2-31913] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: CTDSPL Antibody [NBP2-31913] - Staining of human lung shows moderate membranous positivity in pneumocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Rpn2 Antibody
NB120-2941
Western Blot: Rpn2 Antibody [NB120-2941] - Analysis of proteasome 19S subunit S1 from HeLa cell extract.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Myosin Light Chain
2 Antibody (3B2)
NBP1-30249
Western Blot: Myosin Light Chain 2 Antibody (3B2) [NBP1-30249] - The extracts of Rat heart (60ug) were resolved by SDS-PAGE, transferred to NC membrane and probed with anti-human MYL2 (1:1000). Proteins were visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.
Immunocytochemistry/Immunofluorescence: Myosin Light Chain 2 Antibody (3B2) [NBP1-30249] - Analysis in A431 cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human MYL2 antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Flow Cytometry: Myosin Light Chain 2 Antibody (3B2) [NBP1-30249] - Flow cytometry analysis of MYL2 in A431 cell line, staining at 2-5ug for 1x106cells (red line). The secondary antibody used goat anti-mouse IgG Alexa fluor 488 conjugate. Isotype control antibody was mouse IgG (black line).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
Calmodulin 2
Knockout HeLa Cell Ly
NBP2-66296
Calmodulin 2 Knockout HeLa Cell Lysate
Species: Hu
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Calmodulin 3
Antibody
NBP1-98474
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Species: Hu
Applications: WB
Rhodopsin Antibody
(A531)
NBP2-25159
Western Blot: Rhodopsin Antibody (A531) [NBP2-25159] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (A531) [NBP2-25159] - Pig retinal section stained with NBP2-25159 (green) and counterstained with rabbit polyclonal antibody to NF-M NB300-133 (red) and DNA (blue). Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
MLH1 Antibody
(SP08-04)
NBP2-67381
Western Blot: MLH1 Antibody (SP08-04) [NBP2-67381] - Analysis of MLH1 on A431 cells lysates using anti-MLH1 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: MLH1 Antibody (SP08-04) [NBP2-67381] - Staining MLH1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MLH1 Antibody (SP08-04) [NBP2-67381] - Analysis of paraffin-embedded human tonsil tissue using anti-MLH1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - IHC analysis of formalin fixed paraffin-embedded (FFPE) rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(29 Publications)
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
cleaved ROCK1
Antibody (154C1465)
NB100-56596
Western Blot: cleaved ROCK1 Antibody (154C1465) [NB100-56596] - Analysis using Azide Free version of NB100-56596. Cleaved ROCK-1 in A) untreated, B) 1 hour and C) 4 hour staurosporin-treated (2 uM) Jurkat cells using this antibody. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Ca, Pm, Rb
Applications: WB, ICC/IF
Recombinant Human
Fast skeletal myosin ...
NBP1-72343
SDS-Page: Recombinant Human Fast skeletal myosin light chain 2 Protein [NBP1-72343] - 15% SDS-PAGE (3ug)
Species: Hu
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
RISC Antibody
NBP1-87127
Western Blot: RISC Antibody [NBP1-87127] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RISC Antibody [NBP1-87127] - Staining of human kidney shows strong cytoplasmic positivity(granular pattern) in cells in tubules.
Western Blot: RISC Antibody [NBP1-87127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Integrin alpha 9
Antibody (9E340)
H00003680-M01
Integrin alpha 9 Antibody (9E340)
Species: Hu
Applications: WB, ELISA

Publications for Integrin alpha 9 Antibody (H00003680-M01)(4)


Reviews for Integrin alpha 9 Antibody (H00003680-M01) (0)

There are no reviews for Integrin alpha 9 Antibody (H00003680-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 9 Antibody (H00003680-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Integrin alpha 9 Antibody (H00003680-M01)

Discover related pathways, diseases and genes to Integrin alpha 9 Antibody (H00003680-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 9 Antibody (H00003680-M01)

Discover more about diseases related to Integrin alpha 9 Antibody (H00003680-M01).
 

Pathways for Integrin alpha 9 Antibody (H00003680-M01)

View related products by pathway.

PTMs for Integrin alpha 9 Antibody (H00003680-M01)

Learn more about PTMs related to Integrin alpha 9 Antibody (H00003680-M01).

Blogs on Integrin alpha 9

There are no specific blogs for Integrin alpha 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 9 Antibody (9E340) and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGA9
Entrez
OMIM
Uniprot