Integrin alpha 6/CD49f Antibody (CL6957)

Images

 
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody (CL6957) [NBP2-76523] - Staining of human uterine cervix shows weak to moderate basement membrane positivity in squamous epithelium.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody (CL6957) [NBP2-76523] - Analysis in human placenta and skeletal muscle tissues. Corresponding ITGA6 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody (CL6957) [NBP2-76523] - Staining of human placenta shows strong basement membrane positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody (CL6957) [NBP2-76523] - Staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody (CL6957) [NBP2-76523] - Staining of human prostate shows weak to moderate basement membrane positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clone
CL6957
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Integrin alpha 6/CD49f Antibody (CL6957) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Epitope
PSISIVGTLEAEKER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Integrin alpha 6/CD49f Knockout HeLa Cell Lysate

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88)% and Rat (86)%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Integrin alpha 6/CD49f Antibody (CL6957)

  • CD49 antigen-like family member F
  • CD49f antigen
  • CD49f
  • DKFZp686J01244
  • FLJ18737
  • Integrin alpha 6
  • integrin alpha-6
  • integrin alpha6B
  • integrin, alpha 6
  • ITGA6
  • ITGA6B
  • Platelet gpl
  • VLA-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52680
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, B/N, CyTOF-ready, IF
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-76478
Species: Hu
Applications: WB, IHC, IHC-P, B/N, KD
NB110-89474
Species: Hu, Mu, Rt, Bv, Ce, ChHa, Pm, RM
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Dual ISH-IHC, Single-Cell Western
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP2-48514
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 6/CD49f Antibody (NBP2-76523) (0)

There are no publications for Integrin alpha 6/CD49f Antibody (NBP2-76523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 6/CD49f Antibody (NBP2-76523) (0)

There are no reviews for Integrin alpha 6/CD49f Antibody (NBP2-76523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin alpha 6/CD49f Antibody (NBP2-76523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Integrin alpha 6/CD49f Products

Bioinformatics Tool for Integrin alpha 6/CD49f Antibody (NBP2-76523)

Discover related pathways, diseases and genes to Integrin alpha 6/CD49f Antibody (NBP2-76523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 6/CD49f Antibody (NBP2-76523)

Discover more about diseases related to Integrin alpha 6/CD49f Antibody (NBP2-76523).
 

Pathways for Integrin alpha 6/CD49f Antibody (NBP2-76523)

View related products by pathway.

PTMs for Integrin alpha 6/CD49f Antibody (NBP2-76523)

Learn more about PTMs related to Integrin alpha 6/CD49f Antibody (NBP2-76523).
 

Research Areas for Integrin alpha 6/CD49f Antibody (NBP2-76523)

Find related products by research area.

Blogs on Integrin alpha 6/CD49f

There are no specific blogs for Integrin alpha 6/CD49f, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 6/CD49f Antibody (CL6957) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA6