Integrin alpha 6/CD49f Antibody (4C1)

Images

 
Sandwich ELISA: Integrin alpha 6/CD49f Antibody (4C1) [H00003655-M01] - Detection limit for recombinant GST tagged ITGA6 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin alpha 6/CD49f Antibody (4C1) Summary

Immunogen
ITGA6 (NP_000201, 24 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH
Specificity
ITGA6 (4C1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGA6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 6/CD49f Antibody (4C1)

  • CD49 antigen-like family member F
  • CD49f antigen
  • CD49f
  • DKFZp686J01244
  • FLJ18737
  • Integrin alpha 6
  • integrin alpha-6
  • integrin alpha6B
  • integrin, alpha 6
  • ITGA6
  • ITGA6B
  • Platelet gpl
  • VLA-6

Background

The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
796-IC
Species: Mu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5248
Species: Hu
Applications: IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-48514
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 6/CD49f Antibody (H00003655-M01) (0)

There are no publications for Integrin alpha 6/CD49f Antibody (H00003655-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 6/CD49f Antibody (H00003655-M01) (0)

There are no reviews for Integrin alpha 6/CD49f Antibody (H00003655-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 6/CD49f Antibody (H00003655-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 6/CD49f Products

Bioinformatics Tool for Integrin alpha 6/CD49f Antibody (H00003655-M01)

Discover related pathways, diseases and genes to Integrin alpha 6/CD49f Antibody (H00003655-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 6/CD49f Antibody (H00003655-M01)

Discover more about diseases related to Integrin alpha 6/CD49f Antibody (H00003655-M01).
 

Pathways for Integrin alpha 6/CD49f Antibody (H00003655-M01)

View related products by pathway.

PTMs for Integrin alpha 6/CD49f Antibody (H00003655-M01)

Learn more about PTMs related to Integrin alpha 6/CD49f Antibody (H00003655-M01).
 

Research Areas for Integrin alpha 6/CD49f Antibody (H00003655-M01)

Find related products by research area.

Blogs on Integrin alpha 6/CD49f

There are no specific blogs for Integrin alpha 6/CD49f, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 6/CD49f Antibody (4C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA6
Entrez
OMIM
Uniprot