Integrin alpha 4/CD49d Antibody (2G10)

Images

 
Immunocytochemistry/ Immunofluorescence: Integrin alpha 4/CD49d Antibody (2G10) [H00003676-M02] - Analysis of monoclonal antibody to ITGA4 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin alpha 4/CD49d Antibody (2G10) Summary

Immunogen
ITGA4 (NP_000876, 98 a.a. - 207 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGA4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 4/CD49d Antibody (2G10)

  • 269C wild type
  • CD49 antigen-like family member D
  • CD49d antigen
  • CD49d
  • CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor
  • IA4
  • Integrin alpha 4
  • integrin alpha-4 subunit
  • integrin alpha-4
  • Integrin alpha-IV
  • integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
  • ITGA4
  • MGC90518
  • very late activation protein 4 receptor, alpha 4 subunit
  • VLA-4 subunit alpha
  • VLA-4

Background

Integrin alpha 4 (also called CD49d) is a 150 kDa protein that possesses a large extracellular domain involved in ligand binding, a single transmembrane domain, and an intracellular regulatory domain possessing multiple sites for phosphorylation. Integrin alpha 4 forms heterodimers with integrins beta 1 and beta 7. Integrin alpha 4 is expressed on leukocytes and leukocyte precursors, neural crest cells, and developing skeletal muscles and is essential for embryogenesis, hematopoiesis, and immune responses. The presence of integrin alpha 4 promotes cell migration and inhibits cell spreading and contractility. Integrin alpha 4 function has been implicated in the pathogenesis of multiple diseases including asthma, rheumatoid arthritis, Crohn's disease, ulcerative colitis, hepatitis C, and multiple sclerosis, and therefore, modulation of integrin alpha 4 function has become an important target for drug discovery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
796-IC
Species: Mu
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS

Publications for Integrin alpha 4/CD49d Antibody (H00003676-M02) (0)

There are no publications for Integrin alpha 4/CD49d Antibody (H00003676-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 4/CD49d Antibody (H00003676-M02) (0)

There are no reviews for Integrin alpha 4/CD49d Antibody (H00003676-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin alpha 4/CD49d Antibody (H00003676-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 4/CD49d Products

Bioinformatics Tool for Integrin alpha 4/CD49d Antibody (H00003676-M02)

Discover related pathways, diseases and genes to Integrin alpha 4/CD49d Antibody (H00003676-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 4/CD49d Antibody (H00003676-M02)

Discover more about diseases related to Integrin alpha 4/CD49d Antibody (H00003676-M02).
 

Pathways for Integrin alpha 4/CD49d Antibody (H00003676-M02)

View related products by pathway.

PTMs for Integrin alpha 4/CD49d Antibody (H00003676-M02)

Learn more about PTMs related to Integrin alpha 4/CD49d Antibody (H00003676-M02).
 

Research Areas for Integrin alpha 4/CD49d Antibody (H00003676-M02)

Find related products by research area.

Blogs on Integrin alpha 4/CD49d

There are no specific blogs for Integrin alpha 4/CD49d, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 4/CD49d Antibody (2G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA4
Entrez
Uniprot