Insulin R/CD220 Antibody

Images

 
Western Blot: Insulin R/CD220 Antibody [NBP1-62691] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
Immunohistochemistry: Insulin R/CD220 Antibody [NBP1-62691] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working ...read more

Product Details

Summary
Product Discontinued
View other related Insulin R/CD220 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-62691
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Insulin R/CD220 Antibody Summary

Immunogen
Synthetic peptides corresponding to INSR(insulin receptor) The peptide sequence was selected form the middle region of INSR. Peptide sequence ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR.
Clonality
Polyclonal
Host
Rabbit
Gene
INSR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against INSR and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Insulin R/CD220 Antibody

  • CD 220
  • CD220 antigen
  • CD220
  • EC 2.7.10
  • EC 2.7.10.1
  • HHF5
  • INSR
  • Insulin R
  • insulin receptor
  • InsulinR
  • IR

Background

This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin. INSR binding to insulin stimulates association of the receptor with downstream media

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6347
Species: Hu
Applications: WB
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-62691
Species: Hu
Applications: WB, IHC

Publications for Insulin R/CD220 Antibody (NBP1-62691) (0)

There are no publications for Insulin R/CD220 Antibody (NBP1-62691).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Insulin R/CD220 Antibody (NBP1-62691) (0)

There are no reviews for Insulin R/CD220 Antibody (NBP1-62691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Insulin R/CD220 Antibody (NBP1-62691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Insulin R/CD220 Products

Bioinformatics Tool for Insulin R/CD220 Antibody (NBP1-62691)

Discover related pathways, diseases and genes to Insulin R/CD220 Antibody (NBP1-62691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Insulin R/CD220 Antibody (NBP1-62691)

Discover more about diseases related to Insulin R/CD220 Antibody (NBP1-62691).
 

Pathways for Insulin R/CD220 Antibody (NBP1-62691)

View related products by pathway.

PTMs for Insulin R/CD220 Antibody (NBP1-62691)

Learn more about PTMs related to Insulin R/CD220 Antibody (NBP1-62691).
 

Research Areas for Insulin R/CD220 Antibody (NBP1-62691)

Find related products by research area.

Blogs on Insulin R/CD220

There are no specific blogs for Insulin R/CD220, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Insulin R/CD220 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INSR
Entrez
OMIM
Uniprot