Insulin Antibody


Western Blot: Insulin Antibody [NBP1-87485] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining of human pancreas shows cytoplasmic positivity in islets of Langerhans.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Insulin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Insulin Protein (NBP1-87485PEP)
Read Publications using NBP1-87485.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Insulin Antibody

  • IDDM2
  • ILPR
  • INS
  • Insulin
  • IRDN
  • MODY10
  • proinsulin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for Insulin Antibody (NBP1-87485)(2)

Reviews for Insulin Antibody (NBP1-87485) (0)

There are no reviews for Insulin Antibody (NBP1-87485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Insulin Antibody (NBP1-87485). (Showing 1 - 1 of 1 FAQs).

  1. Will you please recommend me antibodies to insulin, the most suitable for immunohistochemistry in the pancreas of guinea pigs? Desirable to be conjugated with some pigment and there was no need for secondary antibodies.
    • I have carried out a search and the best antibody I recommend is NB600-1488. This is a primary unconjugated antibody however and you will need a secondary. If you click on the product link and then click on related products, a list of all recommended secondary antibodies will appear.

Secondary Antibodies


Isotype Controls

Additional Insulin Products

Bioinformatics Tool for Insulin Antibody (NBP1-87485)

Discover related pathways, diseases and genes to Insulin Antibody (NBP1-87485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Insulin Antibody (NBP1-87485)

Discover more about diseases related to Insulin Antibody (NBP1-87485).

Pathways for Insulin Antibody (NBP1-87485)

View related products by pathway.

PTMs for Insulin Antibody (NBP1-87485)

Learn more about PTMs related to Insulin Antibody (NBP1-87485).

Blogs on Insulin.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer
ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in...  Read full blog post.

Ghrelin: Targeting the Hunger Hormone to Combat Obesity and Type 2 Diabetes
As the hormone ghrelin is linked to appetite and weight gain, as well as impaired glucose-induced insulin secretion, there is considerable interest in this peptide as a potential drug target. Although the overall lack of success in this field has been...  Read full blog post.

Novus Adiponectin Reagents Help to Progress Obesity & Diabetes Research
Adiponectin is most well-known for its role in glucose metabolism and fatty acid breakdown. Adiponectin is secreted solely by adipose tissue, and a person with a higher percentage of body fat will express lower levels of Adiponectin. When higher level...  Read full blog post.

Signalling Advances in Adiponectin Antibody Research
Adiponectin is an adipocytokine protein that positively regulates metabolism of lipids and glucose by suppressing glucose production from the liver, stimulating insulin sensitivity, and increasing the rate of fatty acid oxidation and glucose uptake. I...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Insulin Antibody and receive a gift card or discount.


Gene Symbol INS