INSIG-1 Antibody

Images

 
Western Blot: INSIG-1 Antibody [NBP1-59706] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Product Discontinued
View other related INSIG-1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59706
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

INSIG-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to INSIG1(insulin induced gene 1) The peptide sequence was selected from the middle region of INSIG1. Peptide sequence TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF.
Clonality
Polyclonal
Host
Rabbit
Gene
INSIG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against INSIG1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INSIG-1 Antibody

  • CL6
  • CL-6
  • INSIG-1 membrane protein
  • INSIG-1
  • insulin induced gene 1
  • insulin-induced gene 1 protein
  • MGC1405

Background

Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.Oxysterols regulate cholesterol homeostasis through liver X receptor (LXR) and sterol regulatory element-binding protein (SREBP) mediated signaling pathway. This gene is an insulin-induced gene. It encodes an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. This protein binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59687
Species: Hu
Applications: WB
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-01828
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7550
Species: Hu
Applications: WB
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-15374
Species: Hu
Applications: WB, IHC, IHC-P
NB100-92012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for INSIG-1 Antibody (NBP1-59706) (0)

There are no publications for INSIG-1 Antibody (NBP1-59706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSIG-1 Antibody (NBP1-59706) (0)

There are no reviews for INSIG-1 Antibody (NBP1-59706). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSIG-1 Antibody (NBP1-59706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INSIG-1 Antibody Products

INSIG-1 NBP1-59706

Related Products by Gene

Bioinformatics Tool for INSIG-1 Antibody (NBP1-59706)

Discover related pathways, diseases and genes to INSIG-1 Antibody (NBP1-59706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSIG-1 Antibody (NBP1-59706)

Discover more about diseases related to INSIG-1 Antibody (NBP1-59706).
 

Pathways for INSIG-1 Antibody (NBP1-59706)

View related products by pathway.

PTMs for INSIG-1 Antibody (NBP1-59706)

Learn more about PTMs related to INSIG-1 Antibody (NBP1-59706).
 

Research Areas for INSIG-1 Antibody (NBP1-59706)

Find related products by research area.

Blogs on INSIG-1

There are no specific blogs for INSIG-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol INSIG1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59706 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.