INSIG-1 Antibody


Western Blot: INSIG-1 Antibody [NBP1-59706] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Product Discontinued
View other related INSIG-1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

INSIG-1 Antibody Summary

Synthetic peptides corresponding to INSIG1(insulin induced gene 1) The peptide sequence was selected from the middle region of INSIG1. Peptide sequence TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against INSIG1 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INSIG-1 Antibody

  • CL6
  • CL-6
  • INSIG-1 membrane protein
  • INSIG-1
  • insulin induced gene 1
  • insulin-induced gene 1 protein
  • MGC1405


Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.Oxysterols regulate cholesterol homeostasis through liver X receptor (LXR) and sterol regulatory element-binding protein (SREBP) mediated signaling pathway. This gene is an insulin-induced gene. It encodes an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. This protein binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins. Alternatively spliced transcript variants encoding distinct isoforms have been observed.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu
Applications: WB, ELISA, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for INSIG-1 Antibody (NBP1-59706) (0)

There are no publications for INSIG-1 Antibody (NBP1-59706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSIG-1 Antibody (NBP1-59706) (0)

There are no reviews for INSIG-1 Antibody (NBP1-59706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSIG-1 Antibody (NBP1-59706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional INSIG-1 Products

INSIG-1 NBP1-59706

Bioinformatics Tool for INSIG-1 Antibody (NBP1-59706)

Discover related pathways, diseases and genes to INSIG-1 Antibody (NBP1-59706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSIG-1 Antibody (NBP1-59706)

Discover more about diseases related to INSIG-1 Antibody (NBP1-59706).

Pathways for INSIG-1 Antibody (NBP1-59706)

View related products by pathway.

PTMs for INSIG-1 Antibody (NBP1-59706)

Learn more about PTMs related to INSIG-1 Antibody (NBP1-59706).

Research Areas for INSIG-1 Antibody (NBP1-59706)

Find related products by research area.

Blogs on INSIG-1

There are no specific blogs for INSIG-1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our INSIG-1 Antibody and receive a gift card or discount.


Gene Symbol INSIG1