ING1 Antibody (3E5.)

Images

 
ELISA: ING1 Antibody (3E5) [H00003621-M07] - Detection limit for recombinant GST tagged ING1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related ING1 Primary Antibodies

Order Details


    • Catalog Number
      H00003621-M07
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ING1 Antibody (3E5.) Summary

Immunogen
ING1 (NP_937862.1, 41 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
Localization
Nuclear
Specificity
ING1 - inhibitor of growth family, member 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ING1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ING1 Antibody (3E5.)

  • growth inhibitor ING1
  • growth inhibitory protein ING1
  • ING1
  • inhibitor of growth family, member 1
  • inhibitor of growth protein 1
  • p24ING1c
  • p33
  • p33ING1
  • p33ING1b
  • p47
  • p47ING1a
  • tumor suppressor ING1

Background

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ING1 Antibody (H00003621-M07) (0)

There are no publications for ING1 Antibody (H00003621-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ING1 Antibody (H00003621-M07) (0)

There are no reviews for ING1 Antibody (H00003621-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ING1 Antibody (H00003621-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ING1 Products

Bioinformatics Tool for ING1 Antibody (H00003621-M07)

Discover related pathways, diseases and genes to ING1 Antibody (H00003621-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ING1 Antibody (H00003621-M07)

Discover more about diseases related to ING1 Antibody (H00003621-M07).
 

Pathways for ING1 Antibody (H00003621-M07)

View related products by pathway.

PTMs for ING1 Antibody (H00003621-M07)

Learn more about PTMs related to ING1 Antibody (H00003621-M07).
 

Research Areas for ING1 Antibody (H00003621-M07)

Find related products by research area.

Blogs on ING1.

Understanding the Reasons for Histone H3 K4 Trimethylation (H3K4Me3)
Epigenetic mechanisms allow distinction between the active and inactive compartments of the genome, allowing proper cell lineage and embryogenesis. The trimethylation of Histone 3 at lysine 4 (H3K4Me3) is a common epigenetic histone modification that...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ING1 Antibody (3E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ING1
Entrez
OMIM
Uniprot