Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [DyLight 488]

Images

 

Order Details


    • Catalog Number
      H00003836-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [DyLight 488] Summary

Immunogen
KPNA1 (AAH02374.1, 1 a.a. - 538 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Specificity
KPNA1 - karyopherin alpha 1 (importin alpha 5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KPNA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Rat reactivity reported in customer review.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [DyLight 488]

  • Importin alpha 5
  • importin subunit alpha-1
  • importin-alpha-S1
  • IPOA5
  • karyopherin alpha 1 (importin alpha 5)
  • Karyopherin subunit alpha-1
  • KPNA1
  • NPI-1
  • NPI-1SRP1importin alpha 5
  • Nucleoprotein interactor 1
  • RCH2
  • RCH2RAG cohort protein 2
  • recombination activating gene cohort 2
  • SRP1
  • SRP1-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-31260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-07799
Species: Hu
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-81650
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83762
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003836-M01G
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G) (0)

There are no publications for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G) (0)

There are no reviews for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin alpha 5/KPNA1/SRP1 Products

Bioinformatics Tool for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G)

Discover related pathways, diseases and genes to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G)

Discover more about diseases related to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G).
 

Pathways for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G)

View related products by pathway.

PTMs for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G)

Learn more about PTMs related to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01G).

Blogs on Importin alpha 5/KPNA1/SRP1

There are no specific blogs for Importin alpha 5/KPNA1/SRP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA1
Entrez