IMP Dehydrogenase 2/IMPDH2 Antibody


Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-53028] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IMP Dehydrogenase 2/IMPDH2 Antibody Summary

Synthetic peptides corresponding to IMPDH2(IMP (inosine monophosphate) dehydrogenase 2) The peptide sequence was selected from the C terminal of IMPDH2 (NP_000875). Peptide sequence SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against IMPDH2 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IMP Dehydrogenase 2/IMPDH2 Antibody

  • EC
  • IMDH2
  • IMP (inosine 5'-monophosphate) dehydrogenase 2
  • IMP (inosine monophosphate) dehydrogenase 2
  • IMP Dehydrogenase 2
  • IMP Oxireductase 2
  • IMPD 2
  • IMPD2
  • IMPD2IMP oxireductase 2
  • IMPDH 2
  • IMPDH2
  • inosine 5' phosphate dehydrogenase 2
  • inosine monophosphate dehydrogenase type II
  • inosine-5'-monophosphate dehydrogenase 2


IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB

Publications for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028) (0)

There are no publications for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028) (0)

There are no reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IMP Dehydrogenase 2/IMPDH2 Products

Bioinformatics Tool for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028)

Discover related pathways, diseases and genes to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028)

Discover more about diseases related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028).

Pathways for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028)

View related products by pathway.

PTMs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028)

Learn more about PTMs related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028).

Research Areas for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-53028)

Find related products by research area.

Blogs on IMP Dehydrogenase 2/IMPDH2

There are no specific blogs for IMP Dehydrogenase 2/IMPDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IMP Dehydrogenase 2/IMPDH2 Antibody and receive a gift card or discount.


Gene Symbol IMPDH2