Recombinant Human ILT1/CD85h/LILRA2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ILT1/CD85h/LILRA2 Peptides and Proteins

Order Details


    • Catalog Number
      H00011027-G01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ILT1/CD85h/LILRA2 Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 1-466 of Human LILRA2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR

Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Protein/Peptide Type
Recombinant Protein
Gene
LILRA2

Applications/Dilutions

Application Notes
In Vitro Wheat Germ System + Liposome Technology offers significant advantages over commonly used protein expression platforms:

Higher Yield
Greater Stability
High Expression Success Rate
Native Protein Conformation

This protein has not yet been tested for use in functional studies and/or compound screening.
All experiments requiring biological activity of the protein will not be backed by the Novus Guarantee or be eligible for the Innovator's Reward™ and must be undertaken at the customer's own risk.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
Liquid;25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ILT1/CD85h/LILRA2 Protein

  • CD85 antigen-like family member H
  • CD85h antigen
  • CD85h
  • ILT1
  • ILT-1
  • ILT1CD85H
  • Leukocyte immunoglobulin-like receptor 7
  • leukocyte immunoglobulin-like receptor subfamily A member 2 soluble
  • leukocyte immunoglobulin-like receptor subfamily A member 2
  • leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
  • LILRA2
  • LIR7
  • LIR7LIR-7Immunoglobulin-like transcript 1

Background

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2078
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
MAB20172
Species: Hu
Applications: WB, CyTOF-reported, Neut
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1806
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB30851
Species: Hu
Applications: Flow, CyTOF-ready
AF2425
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-84432
Species: Hu
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01) (0)

There are no publications for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01) (0)

There are no reviews for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ILT1/CD85h/LILRA2 Products

Bioinformatics Tool for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01)

Discover related pathways, diseases and genes to ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01)

Discover more about diseases related to ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01).
 

Pathways for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01)

View related products by pathway.

PTMs for ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01)

Learn more about PTMs related to ILT1/CD85h/LILRA2 Recombinant Protein (H00011027-G01).

Blogs on ILT1/CD85h/LILRA2

There are no specific blogs for ILT1/CD85h/LILRA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ILT1/CD85h/LILRA2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LILRA2
Entrez