ILF3 Antibody

Images

 
Western Blot: ILF3 Antibody [NBP1-69175] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Small Intestine.

Product Details

Summary
Product Discontinued
View other related ILF3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69175
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ILF3 Antibody Summary

Immunogen
Synthetic peptides corresponding to Ilf3 (interleukin enhancer binding factor 3) The peptide sequence was selected from the C terminal of Ilf3. Peptide sequence YQGDSYNSPVPPKHAGKKPLHGGQQKASYSSGYQSHQGQQQPYNQSQYSS.
Clonality
Polyclonal
Host
Rabbit
Gene
ILF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ilf3 and was validated on Western blot.
Theoretical MW
98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ILF3 Antibody

  • Double-stranded RNA-binding protein 76
  • double-stranded RNA-binding protein, 76 kD
  • DRBF
  • DRBP76M-phase phosphoprotein 4
  • dsRNA binding protein NFAR-2/MPP4
  • interleukin enhancer binding factor 3, 90kDa
  • interleukin enhancer-binding factor 3
  • MPHOSPH4interleukin enhancer binding factor 3, 90kD
  • MPP4MMP4
  • NF90CBTF
  • NFAR-1
  • NFAR2
  • NFARNF110
  • NF-AT-90
  • Nuclear factor associated with dsRNA
  • Nuclear factor of activated T-cells 90 kDa
  • nuclear factor of activated T-cells, 90 kD
  • TCP110
  • TCP80
  • Translational control protein 80

Background

The function of Ilf3 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82586
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
AF8519
Species: Hu, Mu, Rt
Applications: WB
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-71840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF7979
Species: Hu, Mu, Rt
Applications: WB
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBL1-07321
Species: Hu
NBP1-69175
Species: Mu
Applications: WB

Publications for ILF3 Antibody (NBP1-69175) (0)

There are no publications for ILF3 Antibody (NBP1-69175).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILF3 Antibody (NBP1-69175) (0)

There are no reviews for ILF3 Antibody (NBP1-69175). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILF3 Antibody (NBP1-69175) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ILF3 Products

Bioinformatics Tool for ILF3 Antibody (NBP1-69175)

Discover related pathways, diseases and genes to ILF3 Antibody (NBP1-69175). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILF3 Antibody (NBP1-69175)

Discover more about diseases related to ILF3 Antibody (NBP1-69175).
 

Pathways for ILF3 Antibody (NBP1-69175)

View related products by pathway.

PTMs for ILF3 Antibody (NBP1-69175)

Learn more about PTMs related to ILF3 Antibody (NBP1-69175).

Blogs on ILF3

There are no specific blogs for ILF3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ILF3