IL1RL1 Antibody


Western Blot: IL1RL1 Antibody [NBP1-69588] - This Anti-IL1RL1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IL1RL1 Antibody Summary

Synthetic peptides corresponding to IL1RL1(interleukin 1 receptor-like 1) The peptide sequence was selected from the N terminal of IL1RL1. Peptide sequence RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IL1RL1 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL1RL1 Antibody

  • DER4ST2growth stimulation-expressed
  • FIT-1
  • IL33R
  • interleukin 1 receptor-like 1
  • interleukin 1 receptor-related protein
  • interleukin-1 receptor-like 1
  • MGC32623
  • Protein ST2
  • ST2L
  • ST2V
  • T1homolog of mouse growth stimulation-expressed


I1RL1 is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Po
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP

Publications for IL1RL1 Antibody (NBP1-69588) (0)

There are no publications for IL1RL1 Antibody (NBP1-69588).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL1RL1 Antibody (NBP1-69588) (0)

There are no reviews for IL1RL1 Antibody (NBP1-69588). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL1RL1 Antibody (NBP1-69588) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IL1RL1 Products

Bioinformatics Tool for IL1RL1 Antibody (NBP1-69588)

Discover related pathways, diseases and genes to IL1RL1 Antibody (NBP1-69588). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL1RL1 Antibody (NBP1-69588)

Discover more about diseases related to IL1RL1 Antibody (NBP1-69588).

Pathways for IL1RL1 Antibody (NBP1-69588)

View related products by pathway.

PTMs for IL1RL1 Antibody (NBP1-69588)

Learn more about PTMs related to IL1RL1 Antibody (NBP1-69588).

Blogs on IL1RL1

There are no specific blogs for IL1RL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL1RL1 Antibody and receive a gift card or discount.


Gene Symbol IL1RL1