Recombinant Human IL1F8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IL1F8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-157 of Human IL1F8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IL36B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL1F8 Protein

  • family of interleukin 1-eta
  • FIL1 eta
  • FIL1
  • FIL1-(ETA)
  • FIL1H
  • IL-1 eta
  • IL1F8 (Canonical product IL-1F8a)
  • IL-1F8 (FIL1-eta)
  • IL-1F8IL1-ETA
  • IL-1H2MGC126880
  • IL1H2MGC126882
  • interleukin 1 family, member 8 (eta)
  • interleukin 1, eta
  • Interleukin-1 eta
  • interleukin-1 family member 8
  • Interleukin-1 homolog 2
  • Interleukin-1 Superfamily e

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2320
Species: Hu
Applications: WB, Block
AF1078
Species: Hu
Applications: WB, IHC
NBP2-33300
Species: Hu
Applications: WB, IHC-P
AF676
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-41241
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF3626
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
AF1975
Species: Hu
Applications: WB

Publications for IL1F8 Recombinant Protein (H00027177-P01) (0)

There are no publications for IL1F8 Recombinant Protein (H00027177-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL1F8 Recombinant Protein (H00027177-P01) (0)

There are no reviews for IL1F8 Recombinant Protein (H00027177-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL1F8 Recombinant Protein (H00027177-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL1F8 Products

Bioinformatics Tool for IL1F8 Recombinant Protein (H00027177-P01)

Discover related pathways, diseases and genes to IL1F8 Recombinant Protein (H00027177-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL1F8 Recombinant Protein (H00027177-P01)

Discover more about diseases related to IL1F8 Recombinant Protein (H00027177-P01).
 

Pathways for IL1F8 Recombinant Protein (H00027177-P01)

View related products by pathway.

Blogs on IL1F8

There are no specific blogs for IL1F8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL1F8 Antibody
NBP1-83892

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL1F8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL36B