IL1F5 Antibody

Images

 
Immunohistochemistry-Paraffin: IL1F5 Antibody [NBP1-83894] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL1F5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL36RN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL1F5 Protein (NBP1-83894PEP)
Publications
Read Publication using NBP1-83894.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23268368)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL1F5 Antibody

  • FIL1 delta
  • FIL1
  • FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta)
  • FIL1DIL-1 delta
  • IL1F5 (Canonical product IL-1F5a)
  • IL-1HY1
  • IL1HY1IL-1-related protein 3
  • IL-1L1
  • IL1L1MGC29840
  • IL-1RP3
  • IL1RP3IL-1ra homolog 1
  • interleukin 1 family, member 5 (delta)
  • interleukin 1, delta
  • interleukin-1 family member 5
  • Interleukin-1 HY1
  • Interleukin-1 receptor antagonist homolog 1
  • Interleukin-1-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33300
Species: Hu
Applications: WB, IHC-P
AF1099
Species: Hu
Applications: WB, IHC, Block, Neut
AF2320
Species: Hu
Applications: WB, Block
AF676
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83894
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for IL1F5 Antibody (NBP1-83894)(1)

Reviews for IL1F5 Antibody (NBP1-83894) (0)

There are no reviews for IL1F5 Antibody (NBP1-83894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL1F5 Antibody (NBP1-83894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL1F5 Products

Bioinformatics Tool for IL1F5 Antibody (NBP1-83894)

Discover related pathways, diseases and genes to IL1F5 Antibody (NBP1-83894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL1F5 Antibody (NBP1-83894)

Discover more about diseases related to IL1F5 Antibody (NBP1-83894).
 

Pathways for IL1F5 Antibody (NBP1-83894)

View related products by pathway.

Blogs on IL1F5

There are no specific blogs for IL1F5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL1F5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL36RN