IL1F5 Antibody

Images

 
Western Blot: IL1F5 Antibody [NBP1-69161] - Titration: 0.2-1 ug/ml, Positive Control: Rat Brain.

Product Details

Summary
Product Discontinued
View other related IL1F5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69161
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL1F5 Antibody Summary

Immunogen
Synthetic peptides corresponding to Il1f5 (interleukin 1 family, member 5 (delta)) The peptide sequence was selected from the C terminal of Il1f5. Peptide sequence LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED.
Clonality
Polyclonal
Host
Rabbit
Gene
IL36RN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Il1f5 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL1F5 Antibody

  • FIL1 delta
  • FIL1
  • FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta)
  • FIL1DIL-1 delta
  • IL1F5 (Canonical product IL-1F5a)
  • IL-1HY1
  • IL1HY1IL-1-related protein 3
  • IL-1L1
  • IL1L1MGC29840
  • IL-1RP3
  • IL1RP3IL-1ra homolog 1
  • interleukin 1 family, member 5 (delta)
  • interleukin 1, delta
  • interleukin-1 family member 5
  • Interleukin-1 HY1
  • Interleukin-1 receptor antagonist homolog 1
  • Interleukin-1-like protein 1

Background

The function of Il1f5 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33300
Species: Hu
Applications: WB, IHC-P
AF1099
Species: Hu
Applications: WB, IHC, Block, Neut
AF2320
Species: Hu
Applications: WB, Block
AF676
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-69161
Species: Rt
Applications: WB

Publications for IL1F5 Antibody (NBP1-69161) (0)

There are no publications for IL1F5 Antibody (NBP1-69161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL1F5 Antibody (NBP1-69161) (0)

There are no reviews for IL1F5 Antibody (NBP1-69161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL1F5 Antibody (NBP1-69161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL1F5 Products

Bioinformatics Tool for IL1F5 Antibody (NBP1-69161)

Discover related pathways, diseases and genes to IL1F5 Antibody (NBP1-69161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL1F5 Antibody (NBP1-69161)

Discover more about diseases related to IL1F5 Antibody (NBP1-69161).
 

Pathways for IL1F5 Antibody (NBP1-69161)

View related products by pathway.

Blogs on IL1F5

There are no specific blogs for IL1F5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL1F5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL36RN
Uniprot