IL11RA Antibody


Western Blot: IL11RA Antibody [NBP2-32671] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IL11RA Antibody [NBP2-32671] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Product Discontinued
View other related IL11RA Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL11RA Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDS
Specificity of human IL11RA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IL11RA Antibody

  • IL-11 receptor subunit alpha
  • IL-11R subunit alpha
  • IL-11RA
  • IL-11R-alpha
  • interleukin 11 receptor, alpha
  • interleukin-11 receptor alpha chain
  • interleukin-11 receptor subunit alpha
  • MGC2146


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Neut
Species: Mu
Applications: WB, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, Neut
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IL11RA Antibody (NBP2-32671) (0)

There are no publications for IL11RA Antibody (NBP2-32671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL11RA Antibody (NBP2-32671) (0)

There are no reviews for IL11RA Antibody (NBP2-32671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL11RA Antibody (NBP2-32671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IL11RA Products

Bioinformatics Tool for IL11RA Antibody (NBP2-32671)

Discover related pathways, diseases and genes to IL11RA Antibody (NBP2-32671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL11RA Antibody (NBP2-32671)

Discover more about diseases related to IL11RA Antibody (NBP2-32671).

Pathways for IL11RA Antibody (NBP2-32671)

View related products by pathway.

PTMs for IL11RA Antibody (NBP2-32671)

Learn more about PTMs related to IL11RA Antibody (NBP2-32671).

Research Areas for IL11RA Antibody (NBP2-32671)

Find related products by research area.

Blogs on IL11RA

There are no specific blogs for IL11RA, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL11RA Antibody and receive a gift card or discount.


Gene Symbol IL11RA