IL11RA Antibody

Images

 
Immunohistochemistry-Paraffin: IL11RA Antibody [NBP2-31997] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL11RA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL11RA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL11RA Protein (NBP2-31997PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL11RA Antibody

  • IL-11 receptor subunit alpha
  • IL-11R subunit alpha
  • IL-11RA
  • IL-11R-alpha
  • interleukin 11 receptor, alpha
  • interleukin-11 receptor alpha chain
  • interleukin-11 receptor subunit alpha
  • MGC2146

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF490
Species: Mu
Applications: WB, Neut
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
AF-303-NA
Species: Hu
Applications: WB, Neut

Publications for IL11RA Antibody (NBP2-31997) (0)

There are no publications for IL11RA Antibody (NBP2-31997).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL11RA Antibody (NBP2-31997) (0)

There are no reviews for IL11RA Antibody (NBP2-31997). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL11RA Antibody (NBP2-31997) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL11RA Products

Bioinformatics Tool for IL11RA Antibody (NBP2-31997)

Discover related pathways, diseases and genes to IL11RA Antibody (NBP2-31997). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL11RA Antibody (NBP2-31997)

Discover more about diseases related to IL11RA Antibody (NBP2-31997).
 

Pathways for IL11RA Antibody (NBP2-31997)

View related products by pathway.

PTMs for IL11RA Antibody (NBP2-31997)

Learn more about PTMs related to IL11RA Antibody (NBP2-31997).
 

Research Areas for IL11RA Antibody (NBP2-31997)

Find related products by research area.

Blogs on IL11RA

There are no specific blogs for IL11RA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL11RA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL11RA
Uniprot