IL-9 Antibody

Images

 
Western Blot: IL-9 Antibody [H00003578-D01P] - Analysis of IL9 expression in transfected 293T cell line by IL9 polyclonal antibody.Lane 1: IL9 transfected lysate(15.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-9 Antibody Summary

Immunogen
IL9 (NP_000581.1, 1 a.a. - 144 a.a.) full-length human protein. MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Specificity
IL9 - interleukin 9,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL9
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-9 Antibody

  • Cytokine P40
  • HP40
  • IL9
  • IL-9
  • IL-9homolog of mouse T cell and mast cell growth factor 40
  • interleukin 9
  • interleukin-9
  • p40 cytokine
  • p40 T-cell and mast cell growth factor
  • P40
  • T-cell growth factor P40

Background

The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003578-D01P
Species: Hu
Applications: WB

Publications for IL-9 Antibody (H00003578-D01P) (0)

There are no publications for IL-9 Antibody (H00003578-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-9 Antibody (H00003578-D01P) (0)

There are no reviews for IL-9 Antibody (H00003578-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-9 Antibody (H00003578-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-9 Products

Bioinformatics Tool for IL-9 Antibody (H00003578-D01P)

Discover related pathways, diseases and genes to IL-9 Antibody (H00003578-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-9 Antibody (H00003578-D01P)

Discover more about diseases related to IL-9 Antibody (H00003578-D01P).
 

Pathways for IL-9 Antibody (H00003578-D01P)

View related products by pathway.

PTMs for IL-9 Antibody (H00003578-D01P)

Learn more about PTMs related to IL-9 Antibody (H00003578-D01P).
 

Research Areas for IL-9 Antibody (H00003578-D01P)

Find related products by research area.

Blogs on IL-9

There are no specific blogs for IL-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL9
Entrez
Uniprot