IL-7 R alpha/CD127 Antibody

Images

 
Western Blot: IL7 Receptor alpha Antibody [NBP1-69157] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Product Discontinued
View other related IL-7 R alpha/CD127 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69157
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-7 R alpha/CD127 Antibody Summary

Immunogen
Synthetic peptides corresponding to IL7R (interleukin 7 receptor) The peptide sequence was selected from the middle region of IL7R. Peptide sequence ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP.
Specificity
This product is specific to Subunit or Isofrom: alpha.
Clonality
Polyclonal
Host
Rabbit
Gene
IL7R
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IL7R and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-7 R alpha/CD127 Antibody

  • CD127 antigen
  • CD127
  • CD127ILRA
  • CDW127
  • IL-7 R alpha
  • IL-7 receptor subunit alpha
  • IL7R alpha
  • IL-7R subunit alpha
  • IL7R
  • IL7RA
  • IL-7Ra
  • IL-7R-alpha
  • interleukin 7 receptor alpha chain
  • interleukin 7 receptor isoform H5-6
  • interleukin 7 receptor
  • interleukin-7 receptor subunit alpha

Background

The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-69157
Species: Hu
Applications: WB

Publications for IL-7 R alpha/CD127 Antibody (NBP1-69157) (0)

There are no publications for IL-7 R alpha/CD127 Antibody (NBP1-69157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-7 R alpha/CD127 Antibody (NBP1-69157) (0)

There are no reviews for IL-7 R alpha/CD127 Antibody (NBP1-69157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-7 R alpha/CD127 Antibody (NBP1-69157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-7 R alpha/CD127 Products

Bioinformatics Tool for IL-7 R alpha/CD127 Antibody (NBP1-69157)

Discover related pathways, diseases and genes to IL-7 R alpha/CD127 Antibody (NBP1-69157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-7 R alpha/CD127 Antibody (NBP1-69157)

Discover more about diseases related to IL-7 R alpha/CD127 Antibody (NBP1-69157).
 

Pathways for IL-7 R alpha/CD127 Antibody (NBP1-69157)

View related products by pathway.

PTMs for IL-7 R alpha/CD127 Antibody (NBP1-69157)

Learn more about PTMs related to IL-7 R alpha/CD127 Antibody (NBP1-69157).
 

Research Areas for IL-7 R alpha/CD127 Antibody (NBP1-69157)

Find related products by research area.

Blogs on IL-7 R alpha/CD127

There are no specific blogs for IL-7 R alpha/CD127, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-7 R alpha/CD127 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL7R
Entrez
Uniprot