Recombinant Human IL-6 Protein (H00003569-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IL-6 Protein Summary

Description
IL-6 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Protein/Peptide Type
Recombinant Protein
Gene
IL6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-6 Protein

  • B cell stimulatory factor-2
  • B-cell differentiation factor
  • BSF-2
  • BSF2CTL differentiation factor
  • CDF
  • HGFHSFIFNB2Hybridoma growth factor
  • IFN-beta-2
  • IL6
  • IL-6
  • IL-6B-cell stimulatory factor 2
  • Interferon beta-2
  • interleukin 6 (interferon, beta 2)
  • interleukin BSF-2
  • interleukin-6
  • MGI-2A

Background

IL6( NP_000591, 1 a.a. - 213 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
H00003569-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for IL-6 Recombinant Protein (H00003569-P01) (0)

There are no publications for IL-6 Recombinant Protein (H00003569-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-6 Recombinant Protein (H00003569-P01) (0)

There are no reviews for IL-6 Recombinant Protein (H00003569-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-6 Recombinant Protein (H00003569-P01). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you know of any blocking antibodies against IL-6 or VEGF-C that can be used in cell culture to quench these cytokines?
    • We have no antibodies that are currently known to show blocking antibodies to VEGF-C. Please see this link to our IL-6 antibodies with blocking/neutralizing activity can be found at this link.

Additional IL-6 Products

Related Products by Gene

Bioinformatics Tool for IL-6 Recombinant Protein (H00003569-P01)

Discover related pathways, diseases and genes to IL-6 Recombinant Protein (H00003569-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-6 Recombinant Protein (H00003569-P01)

Discover more about diseases related to IL-6 Recombinant Protein (H00003569-P01).
 

Pathways for IL-6 Recombinant Protein (H00003569-P01)

View related products by pathway.

PTMs for IL-6 Recombinant Protein (H00003569-P01)

Learn more about PTMs related to IL-6 Recombinant Protein (H00003569-P01).
 

Research Areas for IL-6 Recombinant Protein (H00003569-P01)

Find related products by research area.

Blogs on IL-6.

The role of HIF-2 alpha in the progression and therapy of clear cell renal cell carcinoma
HIF-2 alpha, also known as hypoxia-inducible factor 2, endothelial PAS domain protein-1, and member of PAS superfamily 2 is part of the HIF family of proteins.  The HIF family is composed of HIF-1, HIF-2 and HIF-3, where HIF-2 is a dimeric protein...  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

VEGF: Vascular endothelial growth factor
VEGF is homodimeric, disulfide-linked glycoprotein cytokine that serves as the ligand for FLT1 (VEGFR-1 receptor) and FLK1 (VEGFR-2 receptor) tyrosine kinases. It is a key modulator of physiological angiogenesis, vasculogenesis, and endothelial cell g...  Read full blog post.

TLR2 - I can recognize many foreign pathogens!
TLR2 is a member of the broad family of Toll-like receptors (TLR) that play an important role in pathogen recognition and innate immunity. TLRs, like other pattern recognition receptors (PRRs), recognize endogenous ligands released during cell or tiss...  Read full blog post.

MyD88 Antibodies for IL Signaling and Immunity Research
The myeloid differentiation protein MyD88 (myeloid differentiation primary response protein) was originally identified and characterized as a primary upregulated response gene in interleukin-6 mediated myeloid differentiation. Now, MyD88 is known to b...  Read full blog post.

"Get the skinny" on Adiponectin & Leptin Antibodies
We at Novus Biologicals have an extensive antibody catalog covering lipid and metabolism research, including Adiponectin and leptin antibody products.Excess body fat is linked to many human diseases, including IRS (insulin resistance syndrome), type...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL6
Entrez

Customers Who Bought This Also Bought