IL-6 Antibody (2D12)

Images

 
Western Blot: IL-6 Antibody (2D12) [H00003569-M02] - Analysis of IL6 expression in transfected 293T cell line by IL6 monoclonal antibody (M02), clone 2D12.Lane 1: IL6 transfected lysate(23.7 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Product Discontinued
View other related IL-6 Primary Antibodies

Order Details


    • Catalog Number
      H00003569-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-6 Antibody (2D12) Summary

Immunogen
IL6 (NP_000591 29 a.a. - 212 a.a.) full-length recombinant protein. SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Specificity
interleukin 6 (interferon, beta 2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been use for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-6 Antibody (2D12)

  • B cell stimulatory factor-2
  • B-cell differentiation factor
  • BSF-2
  • BSF2CTL differentiation factor
  • CDF
  • HGFHSFIFNB2Hybridoma growth factor
  • IFN-beta-2
  • IL6
  • IL-6
  • IL-6B-cell stimulatory factor 2
  • Interferon beta-2
  • interleukin 6 (interferon, beta 2)
  • interleukin BSF-2
  • interleukin-6
  • MGI-2A

Background

IL6 is an immunoregulatory cytokine that activates a cell surface signaling assembly composed of IL6, IL6RA (IL6R; MIM 147880), and the shared signaling receptor gp130 (IL6ST; MIM 600694) (Boulanger et al., 2003 [PubMed 12829785]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for IL-6 Antibody (H00003569-M02) (0)

There are no publications for IL-6 Antibody (H00003569-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-6 Antibody (H00003569-M02) (0)

There are no reviews for IL-6 Antibody (H00003569-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-6 Antibody (H00003569-M02). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you know of any blocking antibodies against IL-6 or VEGF-C that can be used in cell culture to quench these cytokines?
    • We have no antibodies that are currently known to show blocking antibodies to VEGF-C. Please see this link to our IL-6 antibodies with blocking/neutralizing activity can be found at this link.

Secondary Antibodies

 

Isotype Controls

Additional IL-6 Products

Bioinformatics Tool for IL-6 Antibody (H00003569-M02)

Discover related pathways, diseases and genes to IL-6 Antibody (H00003569-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-6 Antibody (H00003569-M02)

Discover more about diseases related to IL-6 Antibody (H00003569-M02).
 

Pathways for IL-6 Antibody (H00003569-M02)

View related products by pathway.

PTMs for IL-6 Antibody (H00003569-M02)

Learn more about PTMs related to IL-6 Antibody (H00003569-M02).
 

Research Areas for IL-6 Antibody (H00003569-M02)

Find related products by research area.

Blogs on IL-6.

The role of HIF-2 alpha in the progression and therapy of clear cell renal cell carcinoma
HIF-2 alpha, also known as hypoxia-inducible factor 2, endothelial PAS domain protein-1, and member of PAS superfamily 2 is part of the HIF family of proteins.  The HIF family is composed of HIF-1, HIF-2 and HIF-3, where HIF-2 is a dimeric protein...  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

VEGF: Vascular endothelial growth factor
VEGF is homodimeric, disulfide-linked glycoprotein cytokine that serves as the ligand for FLT1 (VEGFR-1 receptor) and FLK1 (VEGFR-2 receptor) tyrosine kinases. It is a key modulator of physiological angiogenesis, vasculogenesis, and endothelial cell g...  Read full blog post.

TLR2 - I can recognize many foreign pathogens!
TLR2 is a member of the broad family of Toll-like receptors (TLR) that play an important role in pathogen recognition and innate immunity. TLRs, like other pattern recognition receptors (PRRs), recognize endogenous ligands released during cell or tiss...  Read full blog post.

MyD88 Antibodies for IL Signaling and Immunity Research
The myeloid differentiation protein MyD88 (myeloid differentiation primary response protein) was originally identified and characterized as a primary upregulated response gene in interleukin-6 mediated myeloid differentiation. Now, MyD88 is known to b...  Read full blog post.

"Get the skinny" on Adiponectin & Leptin Antibodies
We at Novus Biologicals have an extensive antibody catalog covering lipid and metabolism research, including Adiponectin and leptin antibody products.Excess body fat is linked to many human diseases, including IRS (insulin resistance syndrome), type...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-6 Antibody (2D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL6
Entrez
OMIM
Uniprot