IL-4 R alpha Antibody (4E8.)

Images

 
ELISA: IL-4 R alpha Antibody (4E8.) [H00003566-M03] - Detection limit for recombinant GST tagged IL4R is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4E8.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL-4 R alpha Antibody (4E8.) Summary

Immunogen
IL4R (NP_000409, 26 a.a. - 135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL4R
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-4 R alpha Antibody (4E8.)

  • CD124 antigen
  • CD124
  • IL-4 R alpha
  • IL-4 receptor subunit alpha
  • IL4R alpha
  • IL-4R subunit alpha
  • IL4R
  • IL-4Ra
  • IL4RACD124
  • IL-4R-alpha
  • interleukin 4 receptor
  • interleukin-4 receptor alpha chain
  • interleukin-4 receptor subunit alpha

Background

IL4 is a pleiotropic cytokine produced by activated T cells, mast cells and basophils. It is a ligand for Interleukin 4 receptor. The Interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. IL4 elicits many different biological responses, but has two dominant functions. The first is regulating differentiation of naive CD4+ T cell to the Th2 type. Th2 cells produce IL4, IL5, IL10 and IL13, which tend to favor a humoral immune response while suppressing a cell mediated immune response controlled by Th1 cells. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. The second is regulating IgE and IgG1 production by B cells. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB500-470
Species: Hu
Applications: ELISA, Flow
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF152
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF146
Species: Hu
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
H00003566-M03
Species: Hu
Applications: ELISA

Publications for IL-4 R alpha Antibody (H00003566-M03) (0)

There are no publications for IL-4 R alpha Antibody (H00003566-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-4 R alpha Antibody (H00003566-M03) (0)

There are no reviews for IL-4 R alpha Antibody (H00003566-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-4 R alpha Antibody (H00003566-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-4 R alpha Products

Bioinformatics Tool for IL-4 R alpha Antibody (H00003566-M03)

Discover related pathways, diseases and genes to IL-4 R alpha Antibody (H00003566-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-4 R alpha Antibody (H00003566-M03)

Discover more about diseases related to IL-4 R alpha Antibody (H00003566-M03).
 

Pathways for IL-4 R alpha Antibody (H00003566-M03)

View related products by pathway.

PTMs for IL-4 R alpha Antibody (H00003566-M03)

Learn more about PTMs related to IL-4 R alpha Antibody (H00003566-M03).
 

Research Areas for IL-4 R alpha Antibody (H00003566-M03)

Find related products by research area.

Blogs on IL-4 R alpha

There are no specific blogs for IL-4 R alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-4 R alpha Antibody (4E8.) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL4R
Entrez
Uniprot