IL-4 Antibody (3D11)

Images

 

Product Details

Summary
Product Discontinued
View other related IL-4 Primary Antibodies

Order Details


    • Catalog Number
      H00003565-M01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-4 Antibody (3D11) Summary

Immunogen
IL4 (NP_000580 63 a.a. - 153 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Specificity
Reacts with interleukin 4.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-4 Antibody (3D11)

  • B cell growth factor 1
  • BCDF
  • B-cell stimulatory factor 1
  • BCGF1
  • BCGF-1
  • binetrakin
  • BSF1
  • BSF-1
  • IL4
  • IL-4
  • IL-4B_cell stimulatory factor 1
  • interleukin 4
  • interleukin-4
  • Lymphocyte stimulatory factor 1
  • MGC79402
  • pitrakinra

Background

The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for IL-4 Antibody (H00003565-M01) (0)

There are no publications for IL-4 Antibody (H00003565-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-4 Antibody (H00003565-M01) (0)

There are no reviews for IL-4 Antibody (H00003565-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-4 Antibody (H00003565-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-4 Products

Bioinformatics Tool for IL-4 Antibody (H00003565-M01)

Discover related pathways, diseases and genes to IL-4 Antibody (H00003565-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-4 Antibody (H00003565-M01)

Discover more about diseases related to IL-4 Antibody (H00003565-M01).
 

Pathways for IL-4 Antibody (H00003565-M01)

View related products by pathway.

PTMs for IL-4 Antibody (H00003565-M01)

Learn more about PTMs related to IL-4 Antibody (H00003565-M01).

Blogs on IL-4

There are no specific blogs for IL-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-4 Antibody (3D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL4
Entrez
Uniprot