IL-3 R alpha/CD123 Antibody

Images

 
Western Blot: IL-3 R alpha/CD123 Antibody [NBP1-86549] - Analysis in control (vector only transfected HEK293T lysate) and IL3RA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: IL-3 R alpha/CD123 Antibody [NBP1-86549] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-3 R alpha/CD123 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL3RA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-3 R alpha/CD123 Recombinant Protein Antigen (NBP1-86549PEP)
Publications
Read Publication using NBP1-86549.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-3 R alpha/CD123 Antibody

  • CD123 antigen
  • CD123
  • hIL3Ra
  • hIL-3Ra
  • IL-3 R alpha
  • IL-3 receptor subunit alpha
  • IL3R alpha
  • IL-3R subunit alpha
  • IL3R
  • IL3RA
  • IL-3Ra
  • IL-3R-alpha
  • IL3RAY
  • IL3RX
  • IL3RY
  • interleukin 3 receptor, alpha (low affinity)
  • interleukin-3 receptor subunit alpha
  • MGC34174

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1376
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86549
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IL-3 R alpha/CD123 Antibody (NBP1-86549)(1)

Reviews for IL-3 R alpha/CD123 Antibody (NBP1-86549) (0)

There are no reviews for IL-3 R alpha/CD123 Antibody (NBP1-86549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-3 R alpha/CD123 Antibody (NBP1-86549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-3 R alpha/CD123 Products

Bioinformatics Tool for IL-3 R alpha/CD123 Antibody (NBP1-86549)

Discover related pathways, diseases and genes to IL-3 R alpha/CD123 Antibody (NBP1-86549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-3 R alpha/CD123 Antibody (NBP1-86549)

Discover more about diseases related to IL-3 R alpha/CD123 Antibody (NBP1-86549).
 

Pathways for IL-3 R alpha/CD123 Antibody (NBP1-86549)

View related products by pathway.

PTMs for IL-3 R alpha/CD123 Antibody (NBP1-86549)

Learn more about PTMs related to IL-3 R alpha/CD123 Antibody (NBP1-86549).
 

Research Areas for IL-3 R alpha/CD123 Antibody (NBP1-86549)

Find related products by research area.

Blogs on IL-3 R alpha/CD123

There are no specific blogs for IL-3 R alpha/CD123, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-3 R alpha/CD123 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL3RA
Entrez