IL-3 R alpha/CD123 Antibody

Images

 
Western Blot: IL-3 R alpha/CD123 Antibody [H00003563-B01P] - Analysis of IL3RA expression in transfected 293T cell line by IL3RA polyclonal antibody. Lane 1: IL3RA transfected lysate(43.30 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL-3 R alpha/CD123 Antibody Summary

Immunogen
IL3RA (NP_002174.1, 1 a.a. - 378 a.a.) full-length human protein. MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IL3RA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-3 R alpha/CD123 Antibody

  • CD123 antigen
  • CD123
  • hIL3Ra
  • hIL-3Ra
  • IL-3 R alpha
  • IL-3 receptor subunit alpha
  • IL3R alpha
  • IL-3R subunit alpha
  • IL3R
  • IL3RA
  • IL-3Ra
  • IL-3R-alpha
  • IL3RAY
  • IL3RX
  • IL3RY
  • interleukin 3 receptor, alpha (low affinity)
  • interleukin-3 receptor subunit alpha
  • MGC34174

Background

IL3RA (CD123) is a member of the immunoglobulin superfamily that is expressed on hematopoietic progenitors, basophils, mast cells, and megakaryocytes. This transmembrane glycoprotein can bind IL3 with low affinity but cannot transduce signals without association with additional protein partners. CD123 can complex with either common beta chain (CDw131) or the IL3RB chain to form high affinity heterodimeric IL3 receptors. CDw131 can complex with the Alpha subunits of the mouse IL3R, IL5R and GMCSFR to form high affinity receptors, while the IL3RB subunit is specific for IL3 but binds with low affinity. IL3 binding to the receptor complex can induce proliferation and differentiation of hematopoietic cells. It is present in Hematopoietic progenitors, basophils, mast cells and megakaryocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1376
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003563-B01P
Species: Hu
Applications: WB

Publications for IL-3 R alpha/CD123 Antibody (H00003563-B01P) (0)

There are no publications for IL-3 R alpha/CD123 Antibody (H00003563-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-3 R alpha/CD123 Antibody (H00003563-B01P) (0)

There are no reviews for IL-3 R alpha/CD123 Antibody (H00003563-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-3 R alpha/CD123 Antibody (H00003563-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-3 R alpha/CD123 Products

Bioinformatics Tool for IL-3 R alpha/CD123 Antibody (H00003563-B01P)

Discover related pathways, diseases and genes to IL-3 R alpha/CD123 Antibody (H00003563-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-3 R alpha/CD123 Antibody (H00003563-B01P)

Discover more about diseases related to IL-3 R alpha/CD123 Antibody (H00003563-B01P).
 

Pathways for IL-3 R alpha/CD123 Antibody (H00003563-B01P)

View related products by pathway.

PTMs for IL-3 R alpha/CD123 Antibody (H00003563-B01P)

Learn more about PTMs related to IL-3 R alpha/CD123 Antibody (H00003563-B01P).
 

Research Areas for IL-3 R alpha/CD123 Antibody (H00003563-B01P)

Find related products by research area.

Blogs on IL-3 R alpha/CD123

There are no specific blogs for IL-3 R alpha/CD123, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-3 R alpha/CD123 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL3RA
Entrez
Uniprot