IL-28 R alpha/IFN-lambda R1 Antibody


Western Blot: IL28RA Antibody [NBP1-69636] - This Anti-IL28RA antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IL-28 R alpha/IFN-lambda R1 Antibody Summary

Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV.
This product is specific to Subunit or Isoform: alpha.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IL28RA and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-28 R alpha/IFN-lambda R1 Antibody

  • class II cytokine receptor CRF2/12
  • CRF2/12
  • CRF2-12
  • Cytokine receptor class-II member 12
  • Cytokine receptor family 2 member 12
  • IFN-lambda R1
  • IFN-lambda receptor 1
  • IFN-lambda-R1
  • IFNLR1
  • IL-28 R alpha
  • IL-28 receptor subunit alpha
  • IL28R alpha
  • IL-28R1
  • IL28RA
  • IL-28Ra
  • IL-28R-alpha
  • Interferon lambda receptor 1
  • interferon lambda, receptor 1
  • interleukin 28 receptor A
  • interleukin 28 receptor, alpha (interferon, lambda receptor)
  • interleukin 28 receptor, alpha
  • interleukin or cytokine receptor 2
  • interleukin-28 receptor subunit alpha
  • LICR2
  • Likely interleukin or cytokine receptor 2


IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636) (0)

There are no publications for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636) (0)

There are no reviews for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IL-28 R alpha/IFN-lambda R1 Products

Bioinformatics Tool for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636)

Discover related pathways, diseases and genes to IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for IL-28 R alpha/IFN-lambda R1 Antibody (NBP1-69636)

Find related products by research area.

Blogs on IL-28 R alpha/IFN-lambda R1

There are no specific blogs for IL-28 R alpha/IFN-lambda R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL-28 R alpha/IFN-lambda R1 Antibody and receive a gift card or discount.


Gene Symbol IFNLR1