Recombinant Human IL-27 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related IL-27 Peptides and Proteins

Order Details


    • Catalog Number
      H00246778-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-27 Protein Summary

Description
IL-27 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
IL27

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-27 Protein

  • IL-27 p28 subunit
  • IL-27 subunit alpha
  • IL27
  • IL-27
  • IL27A
  • IL-27-A
  • IL27-A
  • IL27p28
  • IL30
  • interleukin 27
  • interleukin 30
  • interleukin-27 subunit alpha
  • MGC71873
  • p28IL-27A

Background

IL27 - interleukin 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27362
Species: Hu
Applications: WB, IHC, IHC-P, TCS
NBP2-35172
Species: Mu
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19015
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-48011
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1975
Species: Hu
Applications: WB
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IL-27 Partial Recombinant Protein (H00246778-Q01) (0)

There are no publications for IL-27 Partial Recombinant Protein (H00246778-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-27 Partial Recombinant Protein (H00246778-Q01) (0)

There are no reviews for IL-27 Partial Recombinant Protein (H00246778-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-27 Partial Recombinant Protein (H00246778-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-27 Products

Bioinformatics Tool for IL-27 Partial Recombinant Protein (H00246778-Q01)

Discover related pathways, diseases and genes to IL-27 Partial Recombinant Protein (H00246778-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-27 Partial Recombinant Protein (H00246778-Q01)

Discover more about diseases related to IL-27 Partial Recombinant Protein (H00246778-Q01).
 

Pathways for IL-27 Partial Recombinant Protein (H00246778-Q01)

View related products by pathway.

PTMs for IL-27 Partial Recombinant Protein (H00246778-Q01)

Learn more about PTMs related to IL-27 Partial Recombinant Protein (H00246778-Q01).
 

Research Areas for IL-27 Partial Recombinant Protein (H00246778-Q01)

Find related products by research area.

Blogs on IL-27.

Ly6G - a marker for monocytes, granulocytes and neutrophils
Ly6G (Lymphocyte antigen 6 complex locus G6D) is a 21-25kD glycosylphosphatidylinositol (GPI)-linked differentiation antigen that is expressed by myeloid-derived cells in a tightly developmentally-regulated manner in the bone marrow. Monocytes express...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-27 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL27
Entrez