IL-27 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

IL-27 Partial Recombinant Protein Summary

Description
IL-27 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Preparation
Method
in vitro wheat germ expression system
Gene
IL27

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-27 Partial Recombinant Protein

  • IL-27 p28 subunit
  • IL-27 subunit alpha
  • IL27
  • IL-27
  • IL27A
  • IL-27-A
  • IL27-A
  • IL27p28
  • IL30
  • interleukin 27
  • interleukin 30
  • interleukin-27 subunit alpha
  • MGC71873
  • p28IL-27A

Background

IL27 - interleukin 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-35172
Species: Mu
MAB15041
Species: Hu
Applications: WB, IHC, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19015
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS
MAB2894
Species: Hu
Applications: WB
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IL-27 Partial Recombinant Protein (H00246778-Q01) (0)

There are no publications for IL-27 Partial Recombinant Protein (H00246778-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-27 Partial Recombinant Protein (H00246778-Q01) (0)

There are no reviews for IL-27 Partial Recombinant Protein (H00246778-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-27 Partial Recombinant Protein (H00246778-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-27 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for IL-27 Partial Recombinant Protein (H00246778-Q01)

Discover related pathways, diseases and genes to IL-27 Partial Recombinant Protein (H00246778-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-27 Partial Recombinant Protein (H00246778-Q01)

Discover more about diseases related to IL-27 Partial Recombinant Protein (H00246778-Q01).
 

Pathways for IL-27 Partial Recombinant Protein (H00246778-Q01)

View related products by pathway.

PTMs for IL-27 Partial Recombinant Protein (H00246778-Q01)

Learn more about PTMs related to IL-27 Partial Recombinant Protein (H00246778-Q01).
 

Research Areas for IL-27 Partial Recombinant Protein (H00246778-Q01)

Find related products by research area.

Blogs on IL-27.

Ly6G - a marker for monocytes, granulocytes and neutrophils
Ly6G (Lymphocyte antigen 6 complex locus G6D) is a 21-25kD glycosylphosphatidylinositol (GPI)-linked differentiation antigen that is expressed by myeloid-derived cells in a tightly developmentally-regulated manner in the bone marrow. Monocytes express...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol IL27
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00246778-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

IL-27 Recombinant Protein
H00246778-P01-10ug
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106