IL-23A/IL-23 P19 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related IL-23A/IL-23 P19 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-89632PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-23A/IL-23 P19 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL23A.

Source: E.coli

Amino Acid Sequence: SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL23A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89632.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IL-23A/IL-23 P19 Recombinant Protein Antigen

  • IL-23 p19/IL-12 p40
  • IL23
  • IL-23
  • IL23A
  • IL-23A
  • IL-23-A
  • IL-23p19
  • IL-23p19/IL-12p40
  • IL23P19P19
  • interleukin 23 p19 subunit
  • interleukin 23, alpha subunit p19
  • interleukin-23 subunit alpha
  • Interleukin-23 subunit p19
  • JKA3 induced upon T-cell activation
  • MGC79388
  • SGRF
  • SGRFIL-23 subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1975
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for IL-23A/IL-23 P19 Protein (NBP1-89632PEP) (0)

There are no publications for IL-23A/IL-23 P19 Protein (NBP1-89632PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-23A/IL-23 P19 Protein (NBP1-89632PEP) (0)

There are no reviews for IL-23A/IL-23 P19 Protein (NBP1-89632PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for IL-23A/IL-23 P19 Protein (NBP1-89632PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for IL-23A/IL-23 P19 Protein (NBP1-89632PEP)

Discover related pathways, diseases and genes to IL-23A/IL-23 P19 Protein (NBP1-89632PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-23A/IL-23 P19 Protein (NBP1-89632PEP)

Discover more about diseases related to IL-23A/IL-23 P19 Protein (NBP1-89632PEP).
 

Pathways for IL-23A/IL-23 P19 Protein (NBP1-89632PEP)

View related products by pathway.

PTMs for IL-23A/IL-23 P19 Protein (NBP1-89632PEP)

Learn more about PTMs related to IL-23A/IL-23 P19 Protein (NBP1-89632PEP).
 

Research Areas for IL-23A/IL-23 P19 Protein (NBP1-89632PEP)

Find related products by research area.

Blogs on IL-23A/IL-23 P19

There are no specific blogs for IL-23A/IL-23 P19, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-23A/IL-23 P19 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL23A
Entrez