IL-23A/IL-23 P19 Antibody

Images

 
Western Blot: IL-23A/IL-23 P19 Antibody [NBP1-89632] - Analysis in control (vector only transfected HEK293T lysate) and iL23A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: IL-23A/IL-23 P19 Antibody [NBP1-89632] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-23A/IL-23 P19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL23A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-23A/IL-23 P19 Protein (NBP1-89632PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-23A/IL-23 P19 Antibody

  • IL23
  • IL-23
  • IL23A
  • IL-23A
  • IL-23-A
  • IL-23p19
  • IL23P19P19
  • interleukin 23 p19 subunit
  • interleukin 23, alpha subunit p19
  • interleukin-23 subunit alpha
  • Interleukin-23 subunit p19
  • JKA3 induced upon T-cell activation
  • MGC79388
  • SGRF
  • SGRFIL-23 subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1975
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
409-ML/CF
Species: Mu
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for IL-23A/IL-23 P19 Antibody (NBP1-89632) (0)

There are no publications for IL-23A/IL-23 P19 Antibody (NBP1-89632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-23A/IL-23 P19 Antibody (NBP1-89632) (0)

There are no reviews for IL-23A/IL-23 P19 Antibody (NBP1-89632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-23A/IL-23 P19 Antibody (NBP1-89632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-23A/IL-23 P19 Products

Bioinformatics Tool for IL-23A/IL-23 P19 Antibody (NBP1-89632)

Discover related pathways, diseases and genes to IL-23A/IL-23 P19 Antibody (NBP1-89632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-23A/IL-23 P19 Antibody (NBP1-89632)

Discover more about diseases related to IL-23A/IL-23 P19 Antibody (NBP1-89632).
 

Pathways for IL-23A/IL-23 P19 Antibody (NBP1-89632)

View related products by pathway.

PTMs for IL-23A/IL-23 P19 Antibody (NBP1-89632)

Learn more about PTMs related to IL-23A/IL-23 P19 Antibody (NBP1-89632).
 

Research Areas for IL-23A/IL-23 P19 Antibody (NBP1-89632)

Find related products by research area.

Blogs on IL-23A/IL-23 P19

There are no specific blogs for IL-23A/IL-23 P19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-23A/IL-23 P19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL23A
Entrez