Recombinant Human IL-22 R alpha 1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related IL-22 R alpha 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00058985-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-22 R alpha 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human IL22RA1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
IL22RA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-22 R alpha 1 Protein

  • CRF2-9
  • CRF2-9interleukin 22 receptor
  • Cytokine receptor class-II member 9
  • Cytokine receptor family 2 member 9
  • IL-22 R alpha 1
  • IL-22 receptor subunit alpha-1
  • IL22R alpha 1
  • IL22R
  • IL22R1
  • IL22RA1
  • IL-22Ra1
  • IL-22R-alpha-1
  • IL-TIF-R1
  • interleukin 22 receptor, alpha 1
  • interleukin-22 receptor subunit alpha-1
  • zcytoR11

Background

IL22RA1 - interleukin 22 receptor, alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85455
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF874
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
AF1709
Species: Mu
Applications: WB, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
1102-IL/CF
Species: Hu
NB100-56409
Species: Hu, Mu
Applications: WB, Flow
AF1375
Species: Hu
Applications: WB
1965-IL/CF
Species: Hu
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
2915-IL/CF
Species: Mu
H00058985-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01) (0)

There are no publications for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01) (0)

There are no reviews for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-22 R alpha 1 Products

Bioinformatics Tool for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01)

Discover related pathways, diseases and genes to IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01)

Discover more about diseases related to IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01).
 

Pathways for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01)

View related products by pathway.

Research Areas for IL-22 R alpha 1 Partial Recombinant Protein (H00058985-Q01)

Find related products by research area.

Blogs on IL-22 R alpha 1

There are no specific blogs for IL-22 R alpha 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-22 R alpha 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL22RA1
Entrez