IL-22 R alpha 1 Antibody

Images

 
Western Blot: IL-22RA1 Antibody [NBP1-59475] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-22 R alpha 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to IL22RA1(interleukin 22 receptor, alpha 1) The peptide sequence was selected from the middle region of IL22RA1. Peptide sequence YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ.
Specificity
This product is specific to Subunit or Isofrom: alpha-1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL22RA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IL22RA1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-22 R alpha 1 Antibody

  • CRF2-9
  • CRF2-9interleukin 22 receptor
  • Cytokine receptor class-II member 9
  • Cytokine receptor family 2 member 9
  • IL-22 R alpha 1
  • IL-22 receptor subunit alpha-1
  • IL22R alpha 1
  • IL22R
  • IL22R1
  • IL22RA1
  • IL-22Ra1
  • IL-22R-alpha-1
  • IL-TIF-R1
  • interleukin 22 receptor, alpha 1
  • interleukin-22 receptor subunit alpha-1
  • zcytoR11

Background

IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shar

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF874
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
8129-IL/CF
Species: Hu
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
1102-IL/CF
Species: Hu
NB100-56409
Species: Hu, Mu
Applications: WB, Flow
AF1375
Species: Hu
Applications: WB
1965-IL/CF
Species: Hu
NBP1-48011
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
2915-IL/CF
Species: Mu
NBP1-59475
Species: Hu
Applications: WB

Publications for IL-22 R alpha 1 Antibody (NBP1-59475) (0)

There are no publications for IL-22 R alpha 1 Antibody (NBP1-59475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-22 R alpha 1 Antibody (NBP1-59475) (0)

There are no reviews for IL-22 R alpha 1 Antibody (NBP1-59475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-22 R alpha 1 Antibody (NBP1-59475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-22 R alpha 1 Products

Bioinformatics Tool for IL-22 R alpha 1 Antibody (NBP1-59475)

Discover related pathways, diseases and genes to IL-22 R alpha 1 Antibody (NBP1-59475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-22 R alpha 1 Antibody (NBP1-59475)

Discover more about diseases related to IL-22 R alpha 1 Antibody (NBP1-59475).
 

Pathways for IL-22 R alpha 1 Antibody (NBP1-59475)

View related products by pathway.

Research Areas for IL-22 R alpha 1 Antibody (NBP1-59475)

Find related products by research area.

Blogs on IL-22 R alpha 1

There are no specific blogs for IL-22 R alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-22 R alpha 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL22RA1
Entrez
Uniprot