IL-21 R Antibody



Product Details

Product Discontinued
View other related IL-21 R Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-21 R Antibody Summary

Synthetic peptide: CILEMWNLHPSTLTLTWQDQYEELKDEATS, corresponding to N-term amino acids 35-65 of Human IL21 Receptor.
Cell Membrane
IL21 Receptor
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2)
0.1% Sodium Azide
1.0 mg/ml
Immunogen affinity purified

Reactivity Notes

Cross-reacts with Human. Expected to cross-react with Rat (86% identity with immunogen) due to sequence homology. Not yet tested in other species.


The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow
Species: Hu
Applications: Flow, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P

Publications for IL-21 R Antibody (NB100-743) (0)

There are no publications for IL-21 R Antibody (NB100-743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-21 R Antibody (NB100-743) (0)

There are no reviews for IL-21 R Antibody (NB100-743). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for IL-21 R Antibody (NB100-743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-21 R Antibody Products

Related Products by Gene

Bioinformatics Tool for IL-21 R Antibody (NB100-743)

Discover related pathways, diseases and genes to IL-21 R Antibody (NB100-743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-21 R Antibody (NB100-743)

Discover more about diseases related to IL-21 R Antibody (NB100-743).

Pathways for IL-21 R Antibody (NB100-743)

View related products by pathway.

PTMs for IL-21 R Antibody (NB100-743)

Learn more about PTMs related to IL-21 R Antibody (NB100-743).

Blogs on IL-21 R

There are no specific blogs for IL-21 R, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol IL21R

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NB100-743 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.