IL-21 R Antibody

Images

 
Immunohistochemistry: IL21 Receptor Antibody [NB100-743] - Immunohistochemistry on human lung with goat antibody to N-terminus of human IL-21 receptor.

Product Details

Summary
Product Discontinued
View other related IL-21 R Primary Antibodies

Order Details


    • Catalog Number
      NB100-743
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-21 R Antibody Summary

Immunogen
Synthetic peptide: CILEMWNLHPSTLTLTWQDQYEELKDEATS, corresponding to N-term amino acids 35-65 of Human IL21 Receptor.
Localization
Cell Membrane
Specificity
IL21 Receptor
Clonality
Polyclonal
Host
Goat
Gene
IL21R
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500

Reactivity Notes

Cross-reacts with Human. Expected to cross-react with Rat (86% identity with immunogen) due to sequence homology. Not yet tested in other species.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2)
Preservative
0.1% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for IL-21 R Antibody

  • CD360 antigen
  • CD360
  • IL-21 R
  • IL-21 receptor
  • IL21R
  • IL-21R
  • interleukin 21 receptor
  • interleukin-21 receptor
  • MGC10967
  • NILR
  • Novel interleukin receptor

Background

The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

594-ML/CF
Species: Mu
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NB100-743
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P

Publications for IL-21 R Antibody (NB100-743) (0)

There are no publications for IL-21 R Antibody (NB100-743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-21 R Antibody (NB100-743) (0)

There are no reviews for IL-21 R Antibody (NB100-743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-21 R Antibody (NB100-743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-21 R Products

Bioinformatics Tool for IL-21 R Antibody (NB100-743)

Discover related pathways, diseases and genes to IL-21 R Antibody (NB100-743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-21 R Antibody (NB100-743)

Discover more about diseases related to IL-21 R Antibody (NB100-743).
 

Pathways for IL-21 R Antibody (NB100-743)

View related products by pathway.

PTMs for IL-21 R Antibody (NB100-743)

Learn more about PTMs related to IL-21 R Antibody (NB100-743).
 

Research Areas for IL-21 R Antibody (NB100-743)

Find related products by research area.

Blogs on IL-21 R

There are no specific blogs for IL-21 R, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-21 R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL21R
Entrez