IL-21 Antibody


Immunohistochemistry: IL-21 Antibody [NBP1-30074] - Human spleen human IL-21

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P
1.0 mg/ml

Order Details

IL-21 Antibody Summary

Synthetic peptide 78 CFQKAQLKSANTGNNERIINVSIKKLKRKPPS 109 corresponding to N-terminus region of human IL-21
human IL-21
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
10 mM KHPO4, 140 mM NaCl, BSA
0.1% Sodium Azide
1.0 mg/ml
Immunogen affinity purified

Alternate Names for IL-21 Antibody

  • IL21
  • IL-21Za11interleukin-21
  • interleukin 21
  • interleukin-21 isoform


A novel cytokine related to IL2 and IL15 was recently identified and designated IL21. IL21 has been found to be a powerful growth factor for naive B cells. The receptor for IL21 (IL21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL21R forms a complex with the common cytokine receptor g chain, gc, and mediates IL21 signaling. Both IL21R and the gc are necessary for the IL21 function. IL21 and its receptor activate JAKSTAT signaling pathway. IL21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL21 plays a role in the proliferation and maturation of NK, B and T cell populations.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow
Species: Hu
Applications: WB, IHC, ICFlow
Species: Hu, Mu
Applications: Flow, IHC, ICC
Species: Hu, Mu
Applications: WB

Publications for IL-21 Antibody (NBP1-30074) (0)

There are no publications for IL-21 Antibody (NBP1-30074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-21 Antibody (NBP1-30074) (0)

There are no reviews for IL-21 Antibody (NBP1-30074). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-21 Antibody (NBP1-30074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IL-21 Antibody Products

Related Products by Gene

Bioinformatics Tool for IL-21 Antibody (NBP1-30074)

Discover related pathways, diseases and genes to IL-21 Antibody (NBP1-30074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-21 Antibody (NBP1-30074)

Discover more about diseases related to IL-21 Antibody (NBP1-30074).

Pathways for IL-21 Antibody (NBP1-30074)

View related products by pathway.

PTMs for IL-21 Antibody (NBP1-30074)

Learn more about PTMs related to IL-21 Antibody (NBP1-30074).

Research Areas for IL-21 Antibody (NBP1-30074)

Find related products by research area.

Blogs on IL-21.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol IL21

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-30074 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought