IL-21 Antibody

Images

 
Immunohistochemistry: IL-21 Antibody [NBP1-30074] - Human spleen human IL-21

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P
Clonality
Polyclonal
Host
Goat
Conjugate
Unconjugated
Concentration
1.0 mg/ml

Order Details

IL-21 Antibody Summary

Immunogen
Synthetic peptide 78 CFQKAQLKSANTGNNERIINVSIKKLKRKPPS 109 corresponding to N-terminus region of human IL-21
Specificity
human IL-21
Isotype
IgG
Clonality
Polyclonal
Host
Goat
Gene
IL21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:50000
  • Immunohistochemistry 1:250
  • Immunohistochemistry-Paraffin 1:250

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
10mM KHPO4 and 0.14M NaCl
Preservative
0.1% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for IL-21 Antibody

  • IL21
  • IL-21
  • IL-21Za11interleukin-21
  • interleukin 21
  • interleukin-21 isoform

Background

A novel cytokine related to IL2 and IL15 was recently identified and designated IL21. IL21 has been found to be a powerful growth factor for naive B cells. The receptor for IL21 (IL21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL21R forms a complex with the common cytokine receptor g chain, gc, and mediates IL21 signaling. Both IL21R and the gc are necessary for the IL21 function. IL21 and its receptor activate JAKSTAT signaling pathway. IL21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL21 plays a role in the proliferation and maturation of NK, B and T cell populations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
596-MR
Species: Mu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IL-21 Antibody (NBP1-30074) (0)

There are no publications for IL-21 Antibody (NBP1-30074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-21 Antibody (NBP1-30074) (0)

There are no reviews for IL-21 Antibody (NBP1-30074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-21 Antibody (NBP1-30074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-21 Products

Bioinformatics Tool for IL-21 Antibody (NBP1-30074)

Discover related pathways, diseases and genes to IL-21 Antibody (NBP1-30074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-21 Antibody (NBP1-30074)

Discover more about diseases related to IL-21 Antibody (NBP1-30074).
 

Pathways for IL-21 Antibody (NBP1-30074)

View related products by pathway.

PTMs for IL-21 Antibody (NBP1-30074)

Learn more about PTMs related to IL-21 Antibody (NBP1-30074).
 

Research Areas for IL-21 Antibody (NBP1-30074)

Find related products by research area.

Blogs on IL-21.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL21
Entrez
Uniprot