IL-1ra/IL-1F3/IL1RN Antibody

Images

 
Western Blot: IL-1ra/IL-1F3/IL1RN Antibody [H00003557-B01P] - Analysis of IL1RN expression in transfected 293T cell line by IL1RN polyclonal antibody. Lane 1: IL1RN transfected lysate(20.10 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL-1ra/IL-1F3/IL1RN Antibody Summary

Immunogen
IL1RN (NP_776214.1, 1 a.a. - 177 a.a.) full-length human protein. MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IL1RN
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-1ra/IL-1F3/IL1RN Antibody

  • DIRA
  • ICIL-1RA
  • IL1F3
  • IL-1F3
  • IL1ra
  • IL-1ra
  • IL-1ra3
  • IL1RN
  • IL-1RN
  • interleukin 1 receptor antagonist
  • IRAP
  • MVCD4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF6386
Species: Hu
Applications: WB, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003557-B01P
Species: Hu
Applications: WB

Publications for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P) (0)

There are no publications for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P) (0)

There are no reviews for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-1ra/IL-1F3/IL1RN Products

Bioinformatics Tool for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P)

Discover related pathways, diseases and genes to IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P)

Discover more about diseases related to IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P).
 

Pathways for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P)

View related products by pathway.

PTMs for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P)

Learn more about PTMs related to IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P).
 

Research Areas for IL-1ra/IL-1F3/IL1RN Antibody (H00003557-B01P)

Find related products by research area.

Blogs on IL-1ra/IL-1F3/IL1RN

There are no specific blogs for IL-1ra/IL-1F3/IL1RN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-1ra/IL-1F3/IL1RN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1RN
Entrez
Uniprot