Recombinant Human IL-18 R beta/IL-1 R7/ACPL Protein

Images

 

Order Details


    • Catalog Number
      H00008807-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-18 R beta/IL-1 R7/ACPL Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 20-129 of Human IL18RAP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IL18RAP

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-18 R beta/IL-1 R7/ACPL Protein

  • Accessory protein-like
  • AcPL
  • CD218 antigen-like family member B
  • CD218b antigen
  • CD218b
  • CDw218b
  • IL-1 R7
  • IL-18 R beta
  • IL-18 receptor accessory protein
  • IL-18 receptor beta
  • IL18R beta
  • IL-18RAcP
  • IL18RAP
  • IL18RB
  • IL-18Rb
  • IL-18Rbeta
  • IL-18R-beta
  • IL-1R accessory protein-like
  • IL1R7
  • IL-1R7
  • IL-1R-7
  • IL-1RAcPL
  • interleukin 18 receptor accessory protein
  • Interleukin-1 receptor 7
  • interleukin-18 receptor accessory protein
  • Interleukin-18 receptor accessory protein-like
  • Interleukin-18 receptor beta
  • MGC120589
  • MGC120590

Background

IL18RAP - interleukin 18 receptor accessory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB840
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC, Neut
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-201
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008807-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01) (0)

There are no publications for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01) (0)

There are no reviews for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-18 R beta/IL-1 R7/ACPL Products

Bioinformatics Tool for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01)

Discover related pathways, diseases and genes to IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01)

Discover more about diseases related to IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01).
 

Pathways for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01)

View related products by pathway.

PTMs for IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01)

Learn more about PTMs related to IL-18 R beta/IL-1 R7/ACPL Partial Recombinant Protein (H00008807-Q01).

Blogs on IL-18 R beta/IL-1 R7/ACPL

There are no specific blogs for IL-18 R beta/IL-1 R7/ACPL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-18 R beta/IL-1 R7/ACPL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL18RAP
Entrez