IL-18 R beta/IL-1 R7/ACPL Antibody (4G4)

Images

 
Western Blot: IL-18 R beta/IL-1 R7/ACPL Antibody (4G4) [H00008807-M04] - Analysis of IL18RAP expression in transfected 293T cell line by IL18RAP monoclonal antibody (M04), clone 4G4. Lane 1: IL18RAP transfected lysate ...read more
Sandwich ELISA: IL-18 R beta/IL-1 R7/ACPL Antibody (4G4) [H00008807-M04] - Detection limit for recombinant GST tagged IL18RAP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL-18 R beta/IL-1 R7/ACPL Antibody (4G4) Summary

Immunogen
IL18RAP (NP_003844, 20 a.a. - 129 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
Specificity
IL18RAP (4G4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL18RAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00008807-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-18 R beta/IL-1 R7/ACPL Antibody (4G4)

  • Accessory protein-like
  • AcPL
  • CD218 antigen-like family member B
  • CD218b antigen
  • CD218b
  • CDw218b
  • IL-1 R7
  • IL-18 R beta
  • IL-18 receptor accessory protein
  • IL-18 receptor beta
  • IL18R beta
  • IL-18RAcP
  • IL18RAP
  • IL18RB
  • IL-18Rb
  • IL-18Rbeta
  • IL-18R-beta
  • IL-1R accessory protein-like
  • IL1R7
  • IL-1R7
  • IL-1R-7
  • IL-1RAcPL
  • interleukin 18 receptor accessory protein
  • Interleukin-1 receptor 7
  • interleukin-18 receptor accessory protein
  • Interleukin-18 receptor accessory protein-like
  • Interleukin-18 receptor beta
  • MGC120589
  • MGC120590

Background

The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB840
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC, Neut
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-201
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008807-M04
Species: Hu
Applications: WB, ELISA

Publications for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04)(2)

Reviews for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04) (0)

There are no reviews for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-18 R beta/IL-1 R7/ACPL Products

Bioinformatics Tool for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04)

Discover related pathways, diseases and genes to IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04)

Discover more about diseases related to IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04).
 

Pathways for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04)

View related products by pathway.

PTMs for IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04)

Learn more about PTMs related to IL-18 R beta/IL-1 R7/ACPL Antibody (H00008807-M04).

Blogs on IL-18 R beta/IL-1 R7/ACPL

There are no specific blogs for IL-18 R beta/IL-1 R7/ACPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-18 R beta/IL-1 R7/ACPL Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL18RAP
Entrez
OMIM
Uniprot