IL-17RC Recombinant Protein Antigen

Images

 
There are currently no images for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-17RC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL17RC.

Source: E.coli

Amino Acid Sequence: WDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL17RC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83112.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IL-17RC Recombinant Protein Antigen

  • FLJ95963
  • FLJ96005
  • IL-17 RC
  • IL-17 receptor C
  • IL-17 RL
  • IL17F receptor
  • IL17RC
  • IL-17RC
  • IL17Rhom
  • IL17RL
  • IL-17RL
  • IL17-RL
  • interleukin 17 receptor C
  • interleukin-17 receptor C
  • Interleukin-17 receptor homolog
  • Interleukin-17 receptor-like protein
  • MGC10763
  • zcytoR14

Background

IL17RC encodes a single-pass transmembrane protein that shares limited similarity with the interleukin-17 receptor. Multiple alternatively spliced transcript variants encoding different isoforms have been detected for this gene, but the full-length nature of only three have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB177
Species: Hu
Applications: CyTOF-ready, Flow, KO, Neut, WB
DY421
Species: Mu
Applications: ELISA
AF2270
Species: Mu
Applications: CyTOF-ready, Flow, Neut, WB
DY2057
Species: Mu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
1887-ML/CF
Species: Mu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
AF2275
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
233-FB/CF
Species: Hu
Applications: BA
NBP1-83112PEP
Species: Hu
Applications: AC

Publications for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP) (0)

There are no publications for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP) (0)

There are no reviews for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-17RC Products

Bioinformatics Tool for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP)

Discover related pathways, diseases and genes to IL-17RC Recombinant Protein Antigen (NBP1-83112PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP)

Discover more about diseases related to IL-17RC Recombinant Protein Antigen (NBP1-83112PEP).
 

Pathways for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP)

View related products by pathway.

PTMs for IL-17RC Recombinant Protein Antigen (NBP1-83112PEP)

Learn more about PTMs related to IL-17RC Recombinant Protein Antigen (NBP1-83112PEP).

Blogs on IL-17RC

There are no specific blogs for IL-17RC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-17RC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RC