IL-17RB Antibody

Images

 
Western Blot: IL-17 RB Antibody [NBP1-85450] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunohistochemistry-Paraffin: IL-17 RB Antibody [NBP1-85450] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-17RB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG
Specificity
Specificity of human IL-17 RB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL17RB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-17RB Antibody

  • CRL4IL-17 receptor homolog 1
  • cytokine receptor CRL4
  • Cytokine receptor-like 4
  • Evi27
  • EVI27IL-17B receptor
  • IL-17 RB
  • IL-17 receptor B
  • IL-17 RH1
  • IL17BRinterleukin 17B receptor
  • IL-17ER
  • IL17RB
  • IL-17RB
  • IL17Rh1
  • IL-17Rh1
  • IL17RH1MGC5245
  • interleukin 17 receptor B
  • interleukin 17 receptor homolog 1
  • interleukin-17 receptor B
  • Interleukin-17B receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB177
Species: Hu
Applications: WB, Flow, CyTOF-ready, KO, Neut
NBP2-48778
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
6507-IL/CF
Species: Hu
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Pm, Rb
Applications: WB, Flow
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
7537-BF/CF
Species: Hu
NBP1-85450
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IL-17RB Antibody (NBP1-85450) (0)

There are no publications for IL-17RB Antibody (NBP1-85450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17RB Antibody (NBP1-85450) (0)

There are no reviews for IL-17RB Antibody (NBP1-85450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17RB Antibody (NBP1-85450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IL-17RB Products

Bioinformatics Tool for IL-17RB Antibody (NBP1-85450)

Discover related pathways, diseases and genes to IL-17RB Antibody (NBP1-85450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17RB Antibody (NBP1-85450)

Discover more about diseases related to IL-17RB Antibody (NBP1-85450).
 

Pathways for IL-17RB Antibody (NBP1-85450)

View related products by pathway.

Blogs on IL-17RB

There are no specific blogs for IL-17RB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-17RB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RB