Recombinant Human IL-17F Protein

Images

 

Product Details

Summary
Product Discontinued
View other related IL-17F Peptides and Proteins

Order Details


    • Catalog Number
      H00112744-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-17F Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 31 - 140 of Human IL17F partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
IL17F

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-17F Protein

  • Cytokine ML-1
  • IL17F
  • IL-17F
  • IL-17Finterleukin-17F
  • IL24
  • IL-24
  • interleukin 17F
  • Interleukin-24
  • ML-1
  • ML1interleukin-24

Background

IL17F - interleukin 17F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF1709
Species: Mu
Applications: WB, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
1102-IL/CF
Species: Hu
NBP2-25258
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
2915-IL/CF
Species: Mu
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF1375
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
H00112744-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IL-17F Partial Recombinant Protein (H00112744-Q01) (0)

There are no publications for IL-17F Partial Recombinant Protein (H00112744-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17F Partial Recombinant Protein (H00112744-Q01) (0)

There are no reviews for IL-17F Partial Recombinant Protein (H00112744-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17F Partial Recombinant Protein (H00112744-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-17F Products

Bioinformatics Tool for IL-17F Partial Recombinant Protein (H00112744-Q01)

Discover related pathways, diseases and genes to IL-17F Partial Recombinant Protein (H00112744-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17F Partial Recombinant Protein (H00112744-Q01)

Discover more about diseases related to IL-17F Partial Recombinant Protein (H00112744-Q01).
 

Pathways for IL-17F Partial Recombinant Protein (H00112744-Q01)

View related products by pathway.

PTMs for IL-17F Partial Recombinant Protein (H00112744-Q01)

Learn more about PTMs related to IL-17F Partial Recombinant Protein (H00112744-Q01).
 

Research Areas for IL-17F Partial Recombinant Protein (H00112744-Q01)

Find related products by research area.

Blogs on IL-17F

There are no specific blogs for IL-17F, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-17F Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17F
Entrez