Recombinant Human IL-17C Protein

Images

 

Product Details

Summary
Product Discontinued
View other related IL-17C Peptides and Proteins

Order Details


    • Catalog Number
      H00027189-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-17C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human IL17C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
IL17C

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-17C Protein

  • CX2
  • Cytokine CX2
  • IL17C
  • IL-17C
  • IL-17CMGC126884
  • interleukin 17C
  • interleukin-17C
  • MGC138401

Background

The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

594-ML/CF
Species: Mu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
596-MR
Species: Mu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for IL-17C Recombinant Protein (H00027189-P01) (0)

There are no publications for IL-17C Recombinant Protein (H00027189-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17C Recombinant Protein (H00027189-P01) (0)

There are no reviews for IL-17C Recombinant Protein (H00027189-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17C Recombinant Protein (H00027189-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-17C Products

Bioinformatics Tool for IL-17C Recombinant Protein (H00027189-P01)

Discover related pathways, diseases and genes to IL-17C Recombinant Protein (H00027189-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17C Recombinant Protein (H00027189-P01)

Discover more about diseases related to IL-17C Recombinant Protein (H00027189-P01).
 

Pathways for IL-17C Recombinant Protein (H00027189-P01)

View related products by pathway.

Research Areas for IL-17C Recombinant Protein (H00027189-P01)

Find related products by research area.

Blogs on IL-17C

There are no specific blogs for IL-17C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-17C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17C
Entrez