IL-17B Antibody

Images

 
Western Blot: IL-17B Antibody [NBP1-85450] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunohistochemistry-Paraffin: IL-17B Antibody [NBP1-85450] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-17B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL17B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-17B Protein (NBP1-85450PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-17B Antibody

  • Cytokine Zcyto7
  • cytokine-like protein ZCYTO7
  • IL17B
  • IL-17B
  • IL-17Binterleukin-17 beta
  • IL20
  • IL-20interleukin-17B
  • interleukin 17B
  • interleukin 20
  • Interleukin-20
  • MGC138900
  • MGC138901
  • neuronal interleukin-17 related factor
  • Neuronal interleukin-17-related factor
  • NIRF
  • ZCYTO7interleukin-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2915-IL/CF
Species: Mu
2915-IL/CF
Species: Mu
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF1375
Species: Hu
Applications: WB
1965-IL/CF
Species: Hu
NB100-56409
Species: Hu, Mu
Applications: WB, Flow
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IL-17B Antibody (NBP1-85450) (0)

There are no publications for IL-17B Antibody (NBP1-85450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17B Antibody (NBP1-85450) (0)

There are no reviews for IL-17B Antibody (NBP1-85450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17B Antibody (NBP1-85450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-17B Products

Bioinformatics Tool for IL-17B Antibody (NBP1-85450)

Discover related pathways, diseases and genes to IL-17B Antibody (NBP1-85450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17B Antibody (NBP1-85450)

Discover more about diseases related to IL-17B Antibody (NBP1-85450).
 

Pathways for IL-17B Antibody (NBP1-85450)

View related products by pathway.

PTMs for IL-17B Antibody (NBP1-85450)

Learn more about PTMs related to IL-17B Antibody (NBP1-85450).
 

Research Areas for IL-17B Antibody (NBP1-85450)

Find related products by research area.

Blogs on IL-17B

There are no specific blogs for IL-17B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-17B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17B
Entrez