IL-17 RE Antibody (46N8G7) [DyLight 650]

Images

 
There are currently no images for IL-17 RE Antibody (NBP2-27366C).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clone
46N8G7
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 650

IL-17 RE Antibody (46N8G7) [DyLight 650] Summary

Immunogen
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL17RE
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for IL-17 RE Antibody (46N8G7) [DyLight 650]

  • IL-17 RE
  • IL-17 receptor E
  • IL17RE
  • IL-17RE
  • Il25r
  • interleukin 17 receptor E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
MAB342
Species: Hu
Applications: WB, AgAct
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25258
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2988
Species: Mu, Rt
Applications: WB
NB100-56740
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-27366C
Species: Hu
Applications: WB
Supplier Logo

Publications for IL-17 RE Antibody (NBP2-27366C) (0)

There are no publications for IL-17 RE Antibody (NBP2-27366C).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17 RE Antibody (NBP2-27366C) (0)

There are no reviews for IL-17 RE Antibody (NBP2-27366C). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17 RE Antibody (NBP2-27366C) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Biotin Labeled NBP2-27366B
DyLight 350 Labeled NBP2-27366UV
DyLight 405 Labeled NBP2-27366V
DyLight 488 Labeled NBP2-27366G
DyLight 550 Labeled NBP2-27366R
DyLight 680 Labeled NBP2-27366FR
DyLight 755 Labeled NBP2-27366IR
HRP Labeled NBP2-27366H

Additional IL-17 RE Products

Bioinformatics Tool for IL-17 RE Antibody (NBP2-27366C)

Discover related pathways, diseases and genes to IL-17 RE Antibody (NBP2-27366C). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17 RE Antibody (NBP2-27366C)

Discover more about diseases related to IL-17 RE Antibody (NBP2-27366C).
 

Pathways for IL-17 RE Antibody (NBP2-27366C)

View related products by pathway.

Blogs on IL-17 RE

There are no specific blogs for IL-17 RE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-22 [Unconjugated]
782-IL-010/CF
IL-17 RE
7997-MR-025

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-17 RE Antibody (46N8G7) [DyLight 650] and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RE
Entrez