IL-17 RE Antibody (46N7E3) [DyLight 488]

Images

 
There are currently no images for IL-17 RE Antibody (NBP2-27367G).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC-P
Clone
46N7E3
Clonality
Monoclonal
Host
Mouse

IL-17 RE Antibody (46N7E3) [DyLight 488] Summary

Immunogen
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL17RE
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 488
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for IL-17 RE Antibody (46N7E3) [DyLight 488]

  • IL-17 RE
  • IL-17 receptor E
  • IL17RE
  • IL-17RE
  • Il25r
  • interleukin 17 receptor E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
IC9125A
Species: Hu, Mu
Applications: ICFlow
MAB342
Species: Hu
Applications: WB, Flow, AgAct, CyTOF-ready
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB177
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB405R
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Cap), ELISA(Det), ELISA(Det), Neut, ELISA(Sta), ELISA(Sta)
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-61916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56740
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-27367G
Species: Hu
Applications: WB, IHC-P
Supplier Logo

Publications for IL-17 RE Antibody (NBP2-27367G) (0)

There are no publications for IL-17 RE Antibody (NBP2-27367G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17 RE Antibody (NBP2-27367G) (0)

There are no reviews for IL-17 RE Antibody (NBP2-27367G). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17 RE Antibody (NBP2-27367G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Biotin Labeled NBP2-27367B
DyLight 350 Labeled NBP2-27367UV
DyLight 405 Labeled NBP2-27367V
DyLight 550 Labeled NBP2-27367R
DyLight 650 Labeled NBP2-27367C
DyLight 680 Labeled NBP2-27367FR
DyLight 755 Labeled NBP2-27367IR
HRP Labeled NBP2-27367H
PerCP Labeled NBP2-27367PCP

Additional IL-17 RE Products

IL-17 RE NBP2-27367G

Related Products by Gene

Bioinformatics Tool for IL-17 RE Antibody (NBP2-27367G)

Discover related pathways, diseases and genes to IL-17 RE Antibody (NBP2-27367G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17 RE Antibody (NBP2-27367G)

Discover more about diseases related to IL-17 RE Antibody (NBP2-27367G).
 

Pathways for IL-17 RE Antibody (NBP2-27367G)

View related products by pathway.

Blogs on IL-17 RE

There are no specific blogs for IL-17 RE, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our IL-17 RE Antibody (46N7E3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RE
Entrez
Uniprot

Customers Who Bought This Also Bought