IL-17 RE Antibody (46N7E3) [DyLight 488] (NBP2-27367G)

Images

 
There are currently no images for IL-17 RE Antibody (NBP2-27367G).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC-P
Clone
46N7E3
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 488

IL-17 RE Antibody (46N7E3) [DyLight 488] Summary

Immunogen
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL17RE
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for IL-17 RE Antibody (46N7E3) [DyLight 488]

  • IL-17 RE
  • IL-17 receptor E
  • IL17RE
  • IL-17RE
  • Il25r
  • interleukin 17 receptor E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
MAB342
Species: Hu
Applications: WB, AgAct
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25258
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2988
Species: Mu, Rt
Applications: WB
NB100-56740
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Supplier Logo

Publications for IL-17 RE Antibody (NBP2-27367G) (0)

There are no publications for IL-17 RE Antibody (NBP2-27367G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17 RE Antibody (NBP2-27367G) (0)

There are no reviews for IL-17 RE Antibody (NBP2-27367G). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17 RE Antibody (NBP2-27367G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Biotin Labeled NBP2-27367B
DyLight 350 Labeled NBP2-27367UV
DyLight 405 Labeled NBP2-27367V
DyLight 550 Labeled NBP2-27367R
DyLight 650 Labeled NBP2-27367C
DyLight 680 Labeled NBP2-27367FR
DyLight 755 Labeled NBP2-27367IR
HRP Labeled NBP2-27367H
PerCP Labeled NBP2-27367PCP

Additional IL-17 RE Products

IL-17 RE NBP2-27367G

Related Products by Gene

Bioinformatics Tool for IL-17 RE Antibody (NBP2-27367G)

Discover related pathways, diseases and genes to IL-17 RE Antibody (NBP2-27367G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17 RE Antibody (NBP2-27367G)

Discover more about diseases related to IL-17 RE Antibody (NBP2-27367G).
 

Pathways for IL-17 RE Antibody (NBP2-27367G)

View related products by pathway.

Blogs on IL-17 RE

There are no specific blogs for IL-17 RE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371
CD4 Antibody
NBP1-19371
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-17 RE Antibody (46N7E3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RE
Entrez